(data stored in ACNUC8465 zone)

HOGENOMDNA: LACTH_2.PE13

LACTH_2.PE13         Location/Qualifiers
FT   CDS             complement(44522..46297)
FT                   /locus_tag="KLTH0B00418g"
FT                   /gene_family="HOG000234158" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF15941"
FT                   /product="KLTH0B00418p"
FT                   /note="highly similar to uniprot|P43550 Saccharomyces
FT                   cerevisiae YFL053W DAK2 Dihydroxyacetone kinase required
FT                   for detoxification of dihydroxyacetone (DHA) involved in
FT                   stress adaptation"
FT                   /db_xref="GOA:C5DC67"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012734"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC67"
FT                   /protein_id="CAR21377.1"
FT                   /translation="MSQKQFKSDGNIVAPYLLGLARSNPGLTVIEHDRVVFRAASAPSA
FT                   KNKPKVTLVSGGGSGHEPTHAGFVGDGALDAIAAGAIFASPSTKQIFSALKAVESPKGT
FT                   LLIVKNYTGDIIHFGLAAERAKAAGMNVELVAVGDDVSVGKKKGSLVGRRGLGATVLVH
FT                   KIAGAAASHGLELSEVAKIARAVVENSATIAGSLDHCTVPGHKPENNLGPDEYEIGMGI
FT                   HNESGTERRSPLPSIPQLVTELLPLVLGEKEDNTFVEFSPEEDVVLMINNMGGMSNLEL
FT                   GYATEVVSEQLIKKFSIVPKRTMSGTFITALNGPGFGITLLNASKAGPDIMRYFDYPTN
FT                   ASGWNQNYHSAQEWKVLAGGKVPTAPPLETVKNEKPSGVTANYETFSKILQSGIAKVKE
FT                   VEPKVTWYDTIAGDGDCGTTLVSGGRALEEAIQKHTLRLTDAAHGIEDIAYIVEDSMGG
FT                   TSGGLYSIYLSALAKGISDSGDKTLTVDTFREASKTALDALYKYTRARPGYRTLIDALQ
FT                   PFVEALNSGQDPRTAVDAAFKGAEKTRKMDALVGRASYVAKEELSKLDDEGGLPDPGAV
FT                   GLAALLDGLVSAAGY"
     MSQKQFKSDG NIVAPYLLGL ARSNPGLTVI EHDRVVFRAA SAPSAKNKPK VTLVSGGGSG        60
     HEPTHAGFVG DGALDAIAAG AIFASPSTKQ IFSALKAVES PKGTLLIVKN YTGDIIHFGL       120
     AAERAKAAGM NVELVAVGDD VSVGKKKGSL VGRRGLGATV LVHKIAGAAA SHGLELSEVA       180
     KIARAVVENS ATIAGSLDHC TVPGHKPENN LGPDEYEIGM GIHNESGTER RSPLPSIPQL       240
     VTELLPLVLG EKEDNTFVEF SPEEDVVLMI NNMGGMSNLE LGYATEVVSE QLIKKFSIVP       300
     KRTMSGTFIT ALNGPGFGIT LLNASKAGPD IMRYFDYPTN ASGWNQNYHS AQEWKVLAGG       360
     KVPTAPPLET VKNEKPSGVT ANYETFSKIL QSGIAKVKEV EPKVTWYDTI AGDGDCGTTL       420
     VSGGRALEEA IQKHTLRLTD AAHGIEDIAY IVEDSMGGTS GGLYSIYLSA LAKGISDSGD       480
     KTLTVDTFRE ASKTALDALY KYTRARPGYR TLIDALQPFV EALNSGQDPR TAVDAAFKGA       540
     EKTRKMDALV GRASYVAKEE LSKLDDEGGL PDPGAVGLAA LLDGLVSAAG Y                591
//

If you have problems or comments...

PBIL Back to PBIL home page