(data stored in ACNUC8465 zone)

HOGENOMDNA: LACTH_2.PE16

LACTH_2.PE16         Location/Qualifiers
FT   CDS             complement(51712..53412)
FT                   /locus_tag="KLTH0B00484g"
FT                   /gene_family="HOG000141577" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF15934"
FT                   /product="KLTH0B00484p"
FT                   /note="weakly similar to uniprot|Q12300 Saccharomyces
FT                   cerevisiae YDL138W RGT2 Plasma membrane glucose receptor"
FT                   /db_xref="GOA:C5DC70"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC70"
FT                   /protein_id="CAR21380.1"
FT                   /translation="MTVEEKLNGEVTEVGDVASSDQSIKVAAVFKEYEPEKEVLSEVDQ
FT                   IIREYELEDHRELLTRGALWANNPGILETESYSDEDRRVAKQAQERPLSSLSKHMLLAA
FT                   LCTSCAAINFGMDESAIGGAVLQYQKQFNITDPNIQGLTVAAPYLAAACLGSPLTIYLD
FT                   NYVGRKWIVFLSCFIGFAGSLIQGFSNGLGCLLFARLFLGIGMGLNSSTVPIYTAECSP
FT                   AISRGAILMLWQTFIALGVCLGSVFNRAFVNISGSLSWRLMIGSSAVAPFVTGILIFFP
FT                   PESPRWLIAHGKTRESLYSLMKLRPHELSGARDFYILHQSLKFESELENQLSSWQQFLS
FT                   LFTNRRNRFALIVSLIGILGQQYGGVNILVSYTTTILTNAGVDSVTAIAGSIGIGGGCF
FT                   LATFLSTQLIDRFGRRKMLLFTLPMEALCLFWLGGVLNVNDAQSRLGAGLASMYVYVLF
FT                   YGAGIGPVSFTLVAETSSITVRMAHSATCMFVNWILDFCLSMTWPKMESSMTASGGLYF
FT                   YGAFNIVVWILTFLCIPETMRFTLEQLDEIFKVGVSAHIKKSLHRIVRN"
     MTVEEKLNGE VTEVGDVASS DQSIKVAAVF KEYEPEKEVL SEVDQIIREY ELEDHRELLT        60
     RGALWANNPG ILETESYSDE DRRVAKQAQE RPLSSLSKHM LLAALCTSCA AINFGMDESA       120
     IGGAVLQYQK QFNITDPNIQ GLTVAAPYLA AACLGSPLTI YLDNYVGRKW IVFLSCFIGF       180
     AGSLIQGFSN GLGCLLFARL FLGIGMGLNS STVPIYTAEC SPAISRGAIL MLWQTFIALG       240
     VCLGSVFNRA FVNISGSLSW RLMIGSSAVA PFVTGILIFF PPESPRWLIA HGKTRESLYS       300
     LMKLRPHELS GARDFYILHQ SLKFESELEN QLSSWQQFLS LFTNRRNRFA LIVSLIGILG       360
     QQYGGVNILV SYTTTILTNA GVDSVTAIAG SIGIGGGCFL ATFLSTQLID RFGRRKMLLF       420
     TLPMEALCLF WLGGVLNVND AQSRLGAGLA SMYVYVLFYG AGIGPVSFTL VAETSSITVR       480
     MAHSATCMFV NWILDFCLSM TWPKMESSMT ASGGLYFYGA FNIVVWILTF LCIPETMRFT       540
     LEQLDEIFKV GVSAHIKKSL HRIVRN                                            566
//

If you have problems or comments...

PBIL Back to PBIL home page