(data stored in ACNUC8465 zone)

HOGENOMDNA: LACTH_2.PE18

LACTH_2.PE18         Location/Qualifiers
FT   CDS             55345..56889
FT                   /locus_tag="KLTH0B00528g"
FT                   /gene_family="HOG000190808" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF15928"
FT                   /product="KLTH0B00528p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:C5DC72"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016048"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC72"
FT                   /protein_id="CAR21382.1"
FT                   /translation="MTIDHTAKRSSELEVGNAKRAQLTSPKRKNLIVNAFIMGSAGNQS
FT                   VGIWKHPQDKSAELYQSPEYWINLAKLLERGKFNAVFLADVLGPYDVYKGPANVGPVAK
FT                   AGSQWPISDPSYFIPLMAAVTTKLAFGMTISTISEQPYHLARRLGTLDLLTNGRVGWNI
FT                   VTSYLDSASRNLLDGKNLPPNEERYARAGEYVDVIYKLFLSSWRDESFKADKKTGVFTD
FT                   PEGLRHINHVGKYFNVPGPAITHPSQQKLPVIIQAGTSAKGKDLSAKNAEVVFLASLTP
FT                   EALGASIKEIKQIATTKYHRNPSKIKFIGLVTVILGDTHEEAENKYNEYKANYSDEEGA
FT                   KAMFSGWTGVDIDKFEDDEVLSNVDHIAIASAVKKWQTAYPRVEKWTKRAIIDEIKVGG
FT                   SGPVLIGTPQEVASEIQNWVDISDIDGFNFAYTVLPQSFEEIIDKLLPELEKLGLFWHD
FT                   YPNASDSSKYLTFREQLFGEPSLDKTHPASDLRWKADETREAYEARIGEALKKLVL"
     MTIDHTAKRS SELEVGNAKR AQLTSPKRKN LIVNAFIMGS AGNQSVGIWK HPQDKSAELY        60
     QSPEYWINLA KLLERGKFNA VFLADVLGPY DVYKGPANVG PVAKAGSQWP ISDPSYFIPL       120
     MAAVTTKLAF GMTISTISEQ PYHLARRLGT LDLLTNGRVG WNIVTSYLDS ASRNLLDGKN       180
     LPPNEERYAR AGEYVDVIYK LFLSSWRDES FKADKKTGVF TDPEGLRHIN HVGKYFNVPG       240
     PAITHPSQQK LPVIIQAGTS AKGKDLSAKN AEVVFLASLT PEALGASIKE IKQIATTKYH       300
     RNPSKIKFIG LVTVILGDTH EEAENKYNEY KANYSDEEGA KAMFSGWTGV DIDKFEDDEV       360
     LSNVDHIAIA SAVKKWQTAY PRVEKWTKRA IIDEIKVGGS GPVLIGTPQE VASEIQNWVD       420
     ISDIDGFNFA YTVLPQSFEE IIDKLLPELE KLGLFWHDYP NASDSSKYLT FREQLFGEPS       480
     LDKTHPASDL RWKADETREA YEARIGEALK KLVL                                   514
//

If you have problems or comments...

PBIL Back to PBIL home page