(data stored in ACNUC8465 zone)

HOGENOMDNA: LACTH_2.PE25

LACTH_2.PE25         Location/Qualifiers
FT   CDS             73357..74829
FT                   /locus_tag="KLTH0B00836g"
FT                   /gene_family="HOG000158005" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF15899"
FT                   /product="KLTH0B00836p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:C5DC79"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC79"
FT                   /protein_id="CAR21390.1"
FT                   /translation="MSSNLSTAPEEGKKVYATRSRDSGTSESIAALPEAMQQTTKYSSE
FT                   TPLLILENESEHDIQYKTCSWVHTSGLMLSEYIVLAIMSFPWSYSVLGIVPGIILTLFV
FT                   ASTVLYTGLTIIDYCERFPHLKNVCDIGQHLFWGQKWAWYATLVCFLANNTLIQGLHVL
FT                   VGAKYLNTVTDHSLCTVKFGVIVACISFVVSVPRTFSSLSKVAYFSAATMFIAVVLAMI
FT                   FAGVQDHPYGYDGTPVTFRAFPEKGTTFVQGMGAFLNIVYTFVGQITYPQFISEMQRPA
FT                   EFRKVLYIVTTCEIVIFTLAGVIIYVYVGNEYMSAPAFGSLTRTFKIIAFSFAVPTIIF
FT                   AGSLYSNVSGRLLFFTFFKRSKHLYSHTTVGWLTWIGILALTWVGAFIIAEVVPFFSDL
FT                   LSLMSSLFDCWFGFVFWGMAYFKLKEAKYQNPRYYSQLTASEKFHFFIAIFLIAVGLFI
FT                   LGPGLYAAIDSIILNYQDDAYGTVFSCASNGS"
     MSSNLSTAPE EGKKVYATRS RDSGTSESIA ALPEAMQQTT KYSSETPLLI LENESEHDIQ        60
     YKTCSWVHTS GLMLSEYIVL AIMSFPWSYS VLGIVPGIIL TLFVASTVLY TGLTIIDYCE       120
     RFPHLKNVCD IGQHLFWGQK WAWYATLVCF LANNTLIQGL HVLVGAKYLN TVTDHSLCTV       180
     KFGVIVACIS FVVSVPRTFS SLSKVAYFSA ATMFIAVVLA MIFAGVQDHP YGYDGTPVTF       240
     RAFPEKGTTF VQGMGAFLNI VYTFVGQITY PQFISEMQRP AEFRKVLYIV TTCEIVIFTL       300
     AGVIIYVYVG NEYMSAPAFG SLTRTFKIIA FSFAVPTIIF AGSLYSNVSG RLLFFTFFKR       360
     SKHLYSHTTV GWLTWIGILA LTWVGAFIIA EVVPFFSDLL SLMSSLFDCW FGFVFWGMAY       420
     FKLKEAKYQN PRYYSQLTAS EKFHFFIAIF LIAVGLFILG PGLYAAIDSI ILNYQDDAYG       480
     TVFSCASNGS                                                              490
//

If you have problems or comments...

PBIL Back to PBIL home page