(data stored in ACNUC8465 zone)

HOGENOMDNA: LACTH_2.PE29

LACTH_2.PE29         Location/Qualifiers
FT   CDS             complement(79302..81446)
FT                   /locus_tag="KLTH0B00924g"
FT                   /gene_family="HOG000174247" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF15886"
FT                   /product="KLTH0B00924p"
FT                   /note="similar to uniprot|P36037 Saccharomyces cerevisiae
FT                   YKL213C DOA1 WD repeat protein required for ubiquitin-
FT                   mediated protein degradation forms complex with Cdc48p
FT                   plays a role in controlling cellular ubiquitin
FT                   concentration also promotes efficient NHEJ in
FT                   postdiauxic/stationary phase"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013535"
FT                   /db_xref="InterPro:IPR015155"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC83"
FT                   /protein_id="CAR21394.1"
FT                   /translation="MVKKVFKLSATLFGHEQDVKSVAVMSNDEVATCSRDGSVRLWKKG
FT                   SNDMWQDTILYKVDEFINSLCYDKLSRLLYCGGKDTLINSISPLLGELGQEPEFVLVGH
FT                   KSNVCALNSSQGYILSGSWDATAKVWFQGALKHELVGHKASVWDVKMLPEVGFYLTASA
FT                   DGTVKLWEGEKVLKTFSNLHTDVVRHLDISPDGDQFASCSNDGTIKINDMDGNTLRTLK
FT                   GHESFVYCVKYTPCGGLVSCGEDRSVRVWGPDGAVKQVIRVPAVSVWDLDVLPNGDILV
FT                   GCSDSLARIFTCHEGRVAPQQELDTFAKEVERTAISSQTMGFDESKLSPSEALLNPGKE
FT                   GQVIVVKSPNGVNEAHQYTQGAWTKVGDVVSSAGNDKKKEFEGKMYDYVFDVDVTEGAP
FT                   PLKLPFNANGNAYQAADDFLARYELPASYREEVVRFLITNTTGVSLEQDQSSTSNGQSN
FT                   SIPQSKPMSVLPVREYLDIRSFSPDAIFNGVVKLNAQERSFDDEDLAAIGAALHDVEDN
FT                   YELLFAQASIIRSSWSNKIPAYDIMRLIVEYLPHADAMSEFIEEGLGSAMPQLEMLTVR
FT                   TLANCFKNKKWGTELMSKNAVYDSVFQTIEPNRPQASKTVNLAVSIATLIFNYSVMIIK
FT                   SGNLDLLPTVADALNNKFGPSQMIQDSEEAAYRMLVAYGNLATVEPTLLQFAKSIAWIK
FT                   PVKEKYGHLSRFSHVFADLL"
     MVKKVFKLSA TLFGHEQDVK SVAVMSNDEV ATCSRDGSVR LWKKGSNDMW QDTILYKVDE        60
     FINSLCYDKL SRLLYCGGKD TLINSISPLL GELGQEPEFV LVGHKSNVCA LNSSQGYILS       120
     GSWDATAKVW FQGALKHELV GHKASVWDVK MLPEVGFYLT ASADGTVKLW EGEKVLKTFS       180
     NLHTDVVRHL DISPDGDQFA SCSNDGTIKI NDMDGNTLRT LKGHESFVYC VKYTPCGGLV       240
     SCGEDRSVRV WGPDGAVKQV IRVPAVSVWD LDVLPNGDIL VGCSDSLARI FTCHEGRVAP       300
     QQELDTFAKE VERTAISSQT MGFDESKLSP SEALLNPGKE GQVIVVKSPN GVNEAHQYTQ       360
     GAWTKVGDVV SSAGNDKKKE FEGKMYDYVF DVDVTEGAPP LKLPFNANGN AYQAADDFLA       420
     RYELPASYRE EVVRFLITNT TGVSLEQDQS STSNGQSNSI PQSKPMSVLP VREYLDIRSF       480
     SPDAIFNGVV KLNAQERSFD DEDLAAIGAA LHDVEDNYEL LFAQASIIRS SWSNKIPAYD       540
     IMRLIVEYLP HADAMSEFIE EGLGSAMPQL EMLTVRTLAN CFKNKKWGTE LMSKNAVYDS       600
     VFQTIEPNRP QASKTVNLAV SIATLIFNYS VMIIKSGNLD LLPTVADALN NKFGPSQMIQ       660
     DSEEAAYRML VAYGNLATVE PTLLQFAKSI AWIKPVKEKY GHLSRFSHVF ADLL             714
//

If you have problems or comments...

PBIL Back to PBIL home page