(data stored in ACNUC8465 zone)

HOGENOMDNA: LACTH_2.PE3

LACTH_2.PE3          Location/Qualifiers
FT   CDS             complement(7385..9055)
FT                   /locus_tag="KLTH0B00154g"
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF15979"
FT                   /product="KLTH0B00154p"
FT                   /note="weakly similar to uniprot|P38090 Saccharomyces
FT                   cerevisiae YBR132C High affinity polyamine permease,
FT                   preferentially uses spermidine over putrescine; expression
FT                   is down-regulated by osmotic stress; plasma membrane
FT                   carnitine transporter, also functions as a low-affinity
FT                   amino acid permease"
FT                   /db_xref="GOA:C5DC57"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC57"
FT                   /protein_id="CAR21367.1"
FT                   /translation="MSKKENFELAVTTLEEGETTTIHDVGAETIRSLEGQAPSLEERIA
FT                   RRKLFPRQVSMIGIGGAIGTALFVSIGTQIIHGGPGSLLIAFCLWSVVFIGLSQCMCVM
FT                   VTYLPVTGSFVHFTERFVDSSCGFSVGWTYFVCQAANVCFEITAVCLVVEFWTDKIPKA
FT                   ALISILIALFGSLNLFSVFIFGEGEFYLSIGKVILAIGLIFFTIVVMAGGNPQHKVLGF
FT                   KNWSNPGAFAEYISKGSAGKFHGFMSCLIFALYVFWGVDYLGNAASEAMNPRKVIPSSF
FT                   RKVFGRLIIFYIGGAICVGILVPFNDHNMIKAISEGAVGAGASPYVSAMKTLGIGVLPH
FT                   IVNVLILTSIISAGNSSLYSASRVLHRLALEGQAPKLFKITKRGVPIYCCVAVLLVCGL
FT                   AYLSVSNSTNNVLTWFLNVETAAMAIVYIFICISYLQFAKGCKAQNIDLKTLPYSSSFL
FT                   PYLGWHSLFWLVLMLFMNGYAVFLKDSWDLQSFIFSYFMIPFFIVLFAGHKLYKKTRFV
FT                   KPVEMDLFSGIAELAEEDAYWEENPPKMNLLDKAFGFIL"
     MSKKENFELA VTTLEEGETT TIHDVGAETI RSLEGQAPSL EERIARRKLF PRQVSMIGIG        60
     GAIGTALFVS IGTQIIHGGP GSLLIAFCLW SVVFIGLSQC MCVMVTYLPV TGSFVHFTER       120
     FVDSSCGFSV GWTYFVCQAA NVCFEITAVC LVVEFWTDKI PKAALISILI ALFGSLNLFS       180
     VFIFGEGEFY LSIGKVILAI GLIFFTIVVM AGGNPQHKVL GFKNWSNPGA FAEYISKGSA       240
     GKFHGFMSCL IFALYVFWGV DYLGNAASEA MNPRKVIPSS FRKVFGRLII FYIGGAICVG       300
     ILVPFNDHNM IKAISEGAVG AGASPYVSAM KTLGIGVLPH IVNVLILTSI ISAGNSSLYS       360
     ASRVLHRLAL EGQAPKLFKI TKRGVPIYCC VAVLLVCGLA YLSVSNSTNN VLTWFLNVET       420
     AAMAIVYIFI CISYLQFAKG CKAQNIDLKT LPYSSSFLPY LGWHSLFWLV LMLFMNGYAV       480
     FLKDSWDLQS FIFSYFMIPF FIVLFAGHKL YKKTRFVKPV EMDLFSGIAE LAEEDAYWEE       540
     NPPKMNLLDK AFGFIL                                                       556
//

If you have problems or comments...

PBIL Back to PBIL home page