(data stored in ACNUC8465 zone)

HOGENOMDNA: LACTH_2.PE30

LACTH_2.PE30         Location/Qualifiers
FT   CDS             81585..83456
FT                   /locus_tag="KLTH0B00946g"
FT                   /gene_family="HOG000189112" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF15885"
FT                   /product="KLTH0B00946p"
FT                   /note="similar to uniprot|P32368 Saccharomyces cerevisiae
FT                   YKL212W SAC1 Lipid phosphoinositide phosphatase of the ER
FT                   and Golgi involved in protein trafficking and secretion"
FT                   /db_xref="InterPro:IPR002013"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC84"
FT                   /protein_id="CAR21395.1"
FT                   /translation="MAGPLLYSHLGEKIVFKLATPSSEKDVVLSLGPSGQDISLESPEI
FT                   FPTRGKIVKSAALIGCIKLKLNSYAIFAHRVEEFGVLAGHRIFKVVEHTILPLNKGGQR
FT                   DKDEQQYLDLLEMQLSSATLFYSYTYDLTNSAQRNEKLDGSSWKTADTRFFWNHYVTHS
FT                   LRTLAEKCPAAGDFIQPMIFGYAHFIETALNNVPITIGLVTRRSRFRAGTRYFRRGIDS
FT                   DGNVANFNETEQFLLVKKPEGGNSEFFSFLQTRGSVPVYWGEINNLKYKPNLVLGENSS
FT                   LDATAKHFDQQKSLYGENYLVNLVNQKGHELPVKNAYESAVNALNDPMIHYVYFDFHHE
FT                   CRKMKWYRVKLLIDHLQKMGLDPEDTFHKIVSPDGKTVDVVREQKSVVRTNCMDCLDRT
FT                   NVVQSVLASWVLQHEFQIANVVPEGTLWELDLKLLAKFQNFWADNADAVSFSYSGTGAL
FT                   KTDFTRTGKRTRKGAFADFMNSVSRYYQNNLSDGPRQDSFDLFHGNFLPFENSFQSPFP
FT                   DRRPLSIQIVPTVICAAITVIAATVFFPKGHFFSTKNLSFFFVSSAIVILSLRFIFRNG
FT                   EQYVNWPKFNNLGFLTAVQTHNKERTFKGIRYVQSPKFSKPGELKRD"
     MAGPLLYSHL GEKIVFKLAT PSSEKDVVLS LGPSGQDISL ESPEIFPTRG KIVKSAALIG        60
     CIKLKLNSYA IFAHRVEEFG VLAGHRIFKV VEHTILPLNK GGQRDKDEQQ YLDLLEMQLS       120
     SATLFYSYTY DLTNSAQRNE KLDGSSWKTA DTRFFWNHYV THSLRTLAEK CPAAGDFIQP       180
     MIFGYAHFIE TALNNVPITI GLVTRRSRFR AGTRYFRRGI DSDGNVANFN ETEQFLLVKK       240
     PEGGNSEFFS FLQTRGSVPV YWGEINNLKY KPNLVLGENS SLDATAKHFD QQKSLYGENY       300
     LVNLVNQKGH ELPVKNAYES AVNALNDPMI HYVYFDFHHE CRKMKWYRVK LLIDHLQKMG       360
     LDPEDTFHKI VSPDGKTVDV VREQKSVVRT NCMDCLDRTN VVQSVLASWV LQHEFQIANV       420
     VPEGTLWELD LKLLAKFQNF WADNADAVSF SYSGTGALKT DFTRTGKRTR KGAFADFMNS       480
     VSRYYQNNLS DGPRQDSFDL FHGNFLPFEN SFQSPFPDRR PLSIQIVPTV ICAAITVIAA       540
     TVFFPKGHFF STKNLSFFFV SSAIVILSLR FIFRNGEQYV NWPKFNNLGF LTAVQTHNKE       600
     RTFKGIRYVQ SPKFSKPGEL KRD                                               623
//

If you have problems or comments...

PBIL Back to PBIL home page