(data stored in ACNUC8465 zone)

HOGENOMDNA: LACTH_2.PE31

LACTH_2.PE31         Location/Qualifiers
FT   CDS             complement(83522..84985)
FT                   /locus_tag="KLTH0B00968g"
FT                   /gene_family="HOG000280459" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF15884"
FT                   /product="KLTH0B00968p"
FT                   /note="highly similar to uniprot|P00937 Saccharomyces
FT                   cerevisiae YKL211C TRP3 anthranilate synthase Component II
FT                   and indole-3-phosphate (multifunctional enzyme)"
FT                   /db_xref="GOA:C5DC85"
FT                   /db_xref="InterPro:IPR000991"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR006220"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR011702"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC85"
FT                   /protein_id="CAR21396.1"
FT                   /translation="MVFSAKRRVVLIDNYDSFTWNLYEYLCQEGAEVLVYRNDQITLEE
FT                   IDDLKPDCVFISPGPGHPRTDSGISRDCVRHFAGKIPVVGVCMGLQCMFDVFGGTVSYA
FT                   GEIVHGKTSQVTHDNKGIFKDIPQGVAVSRYHSLAGEPLSLPEVLEVTARTENGIIMGV
FT                   RHKNLTVEGVQFHPESILTEAGHVMVRNILNIQGGTWEEHEKLSKEKRVKGSSILDKIY
FT                   AQRQKDVDELSATPGFTLRDLQSNFNQGLAPEVQDFYTKLSSGPKSAVIAEIKRASPSK
FT                   GDIDMNAIAAEQGLKYAKAGASAISVLTEPHWFKGSIQDLVNVRRALDIEFKNAPQDRP
FT                   CVLRKEFIFSKYQILEARLAGADSVLLIVKMLSQDLLLELYNYSKFEVGIEPLVEVSSK
FT                   EEMGRALELNAKVVGVNNRDLHSFNVDLNTTSSLASSVPEGTILLALSGITSGADAEKY
FT                   KKEGVKGLLVGEALMRAANVDSLIKDLSA"
     MVFSAKRRVV LIDNYDSFTW NLYEYLCQEG AEVLVYRNDQ ITLEEIDDLK PDCVFISPGP        60
     GHPRTDSGIS RDCVRHFAGK IPVVGVCMGL QCMFDVFGGT VSYAGEIVHG KTSQVTHDNK       120
     GIFKDIPQGV AVSRYHSLAG EPLSLPEVLE VTARTENGII MGVRHKNLTV EGVQFHPESI       180
     LTEAGHVMVR NILNIQGGTW EEHEKLSKEK RVKGSSILDK IYAQRQKDVD ELSATPGFTL       240
     RDLQSNFNQG LAPEVQDFYT KLSSGPKSAV IAEIKRASPS KGDIDMNAIA AEQGLKYAKA       300
     GASAISVLTE PHWFKGSIQD LVNVRRALDI EFKNAPQDRP CVLRKEFIFS KYQILEARLA       360
     GADSVLLIVK MLSQDLLLEL YNYSKFEVGI EPLVEVSSKE EMGRALELNA KVVGVNNRDL       420
     HSFNVDLNTT SSLASSVPEG TILLALSGIT SGADAEKYKK EGVKGLLVGE ALMRAANVDS       480
     LIKDLSA                                                                 487
//

If you have problems or comments...

PBIL Back to PBIL home page