(data stored in ACNUC7421 zone)

EMBL: M13766.PE1

M13766.PE1           Location/Qualifiers
FT   CDS             <1..1193
FT                   /codon_start=3
FT                   /transl_table=11
FT                   /note="penicillin binding protein 5"
FT                   /db_xref="GOA:P08750"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08750"
FT                   /protein_id="AAA22375.1"
FT                   /translation="ASSGKILYSKNADKRLPIASMTKMMTEYLLLEAIDQGKVKWDQTY
FT                   TPDDYVYEISQDNSLSNVPLRKDGKYTVKELYQATAIYSANAAAIAIAEIVAGSETKFV
FT                   EKMNAKAKELGLTDYKFVNATGLENKDLHGHQPEGTSVNEESEVSAKDMAVLADHLITD
FT                   YPEILETSSIAKTKFRQGTDDEMDMPNWNFMLKGLVSEYKKATVDGLKTGSTDSAGSCF
FT                   TGTAERNGMRVITVVLNAKGNLHTGRFDETKKMFDYAFDNFSMKEIYAEGDQVKGHKTI
FT                   SVDKGKEKEVGIVTNKAFSLPVKNGEEKNYKAKVTLNKDNLTAPVKKGTKVGKLTAEYT
FT                   GDEKDYGFLNSDLAGVDLVTKENVEKANWFVLTMRSIGGFFAGIWGSIVDTVTGWF"
     ASSGKILYSK NADKRLPIAS MTKMMTEYLL LEAIDQGKVK WDQTYTPDDY VYEISQDNSL        60
     SNVPLRKDGK YTVKELYQAT AIYSANAAAI AIAEIVAGSE TKFVEKMNAK AKELGLTDYK       120
     FVNATGLENK DLHGHQPEGT SVNEESEVSA KDMAVLADHL ITDYPEILET SSIAKTKFRQ       180
     GTDDEMDMPN WNFMLKGLVS EYKKATVDGL KTGSTDSAGS CFTGTAERNG MRVITVVLNA       240
     KGNLHTGRFD ETKKMFDYAF DNFSMKEIYA EGDQVKGHKT ISVDKGKEKE VGIVTNKAFS       300
     LPVKNGEEKN YKAKVTLNKD NLTAPVKKGT KVGKLTAEYT GDEKDYGFLN SDLAGVDLVT       360
     KENVEKANWF VLTMRSIGGF FAGIWGSIVD TVTGWF                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page