(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE1

MICSR_1.PE1          Location/Qualifiers
FT   CDS             join(complement(1474..1486),complement(482..1239))
FT                   /codon_start=1
FT                   /gene_family="HOG000116557" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636006"
FT                   /orf_name="MICPUN_99220"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62028.1"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="UniParc:UPI000199A9E9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0M8"
FT                   /transl_table=1
FT                   /translation="MARRTDELADGDRAAHLAENQLTSVPAEIGHLTSLERLELNHNEL
FT                   TRVPAEIGLLTSLRALSLSSNKLTSVPVEIGQLTSLTALFLGDNLLTRVPAEVGQLASL
FT                   EGLFLGDNRLTSVLAEIGQLTSLTELSLGNNQLTSLPAEIGRLTSLTALLLYDNQLTSV
FT                   PAEIGQLTSLVKLSLTENQLTSLPAEIGQLTSLTELYLYGNQLTSVPAEIGQLTSLVRL
FT                   YLGDNRLTSVPAAIRELRAAGCNVRMDNGVTVDE"
     MARRTDELAD GDRAAHLAEN QLTSVPAEIG HLTSLERLEL NHNELTRVPA EIGLLTSLRA        60
     LSLSSNKLTS VPVEIGQLTS LTALFLGDNL LTRVPAEVGQ LASLEGLFLG DNRLTSVLAE       120
     IGQLTSLTEL SLGNNQLTSL PAEIGRLTSL TALLLYDNQL TSVPAEIGQL TSLVKLSLTE       180
     NQLTSLPAEI GQLTSLTELY LYGNQLTSVP AEIGQLTSLV RLYLGDNRLT SVPAAIRELR       240
     AAGCNVRMDN GVTVDE                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page