(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE10

MICSR_1.PE10         Location/Qualifiers
FT   CDS             21162..23291
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636015"
FT                   /orf_name="MICPUN_99225"
FT                   /product="Predicted protein"
FT                   /function="tRNA (guanine-N7-)-methyltransferase activity "
FT                   /protein_id="ACO61589.1"
FT                   /db_xref="GO:0008176"
FT                   /db_xref="HOGENOM:HBG559982"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="UniParc:UPI000199AA51"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0N7"
FT                   /transl_table=1
FT                   /translation="MVETCAMVGCFAENCDNYLTVDLEPEDFSGGSTSRSSRATEPRER
FT                   VRVDVSRDMKRLRVFDGSSFEGPSPRSAKFKRRIARYFPGSATAADERLDAEARGVKEV
FT                   REAPASIEVVEEPDEPPFAEAATNDEPDEKPNAAKTGDEVEPVPYSSLAALDEGMARIM
FT                   KSNRKRSRDAQTLLKRAVKTKEIKFFNRIIKDFGNDKQMGFAEEAFRRIGDAGLSPTVY
FT                   SYTNLLNACVRVGELDRARKVWDDMIAAGVDPNEVTYTVLVKGLAQDGLLAEAARTVRD
FT                   MTAQSRAGVEGVAPNVRTFSTLLRNCVRHADPGVADECIAAMRDADVKPDVASFEYLLK
FT                   ARCAAMDAKGAWAVVDDMDREYLEVPPQAHAALATVSSLTGDVEKARSACEAARQAVKD
FT                   NGAGTVEDDGAGELFGSRGGYGSDSDEPKAANEQVKGRKKDKRHSQQQQQQQQQEEASK
FT                   SVQQFLKLRNSDALRQVEEVEKFLALGDDFVKEVAAVVNRGPESESSPVLIVEGAANVK
FT                   KPLCFKEVFGNDLPVRLEVCSGHGDWVTERAQRDEGKANWLALEMRRNRIRMTWAKAVR
FT                   RRLDNVALLCGMAHEMMGAHVPSGSLTEVYVNYPDPPEWVGSSQCLVDQAFLRDAHRSL
FT                   KPGVGHLTLVTDDPNYAMRMCRELSKVLRLFKPTEHGGKPFKSGVPEGYGGSYFDEMWK
FT                   NGRQNDRYYIRYKRV"
     MVETCAMVGC FAENCDNYLT VDLEPEDFSG GSTSRSSRAT EPRERVRVDV SRDMKRLRVF        60
     DGSSFEGPSP RSAKFKRRIA RYFPGSATAA DERLDAEARG VKEVREAPAS IEVVEEPDEP       120
     PFAEAATNDE PDEKPNAAKT GDEVEPVPYS SLAALDEGMA RIMKSNRKRS RDAQTLLKRA       180
     VKTKEIKFFN RIIKDFGNDK QMGFAEEAFR RIGDAGLSPT VYSYTNLLNA CVRVGELDRA       240
     RKVWDDMIAA GVDPNEVTYT VLVKGLAQDG LLAEAARTVR DMTAQSRAGV EGVAPNVRTF       300
     STLLRNCVRH ADPGVADECI AAMRDADVKP DVASFEYLLK ARCAAMDAKG AWAVVDDMDR       360
     EYLEVPPQAH AALATVSSLT GDVEKARSAC EAARQAVKDN GAGTVEDDGA GELFGSRGGY       420
     GSDSDEPKAA NEQVKGRKKD KRHSQQQQQQ QQQEEASKSV QQFLKLRNSD ALRQVEEVEK       480
     FLALGDDFVK EVAAVVNRGP ESESSPVLIV EGAANVKKPL CFKEVFGNDL PVRLEVCSGH       540
     GDWVTERAQR DEGKANWLAL EMRRNRIRMT WAKAVRRRLD NVALLCGMAH EMMGAHVPSG       600
     SLTEVYVNYP DPPEWVGSSQ CLVDQAFLRD AHRSLKPGVG HLTLVTDDPN YAMRMCRELS       660
     KVLRLFKPTE HGGKPFKSGV PEGYGGSYFD EMWKNGRQND RYYIRYKRV                   709
//

If you have problems or comments...

PBIL Back to PBIL home page