(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE100

MICSR_1.PE100        Location/Qualifiers
FT   CDS             join(194212..194274,194411..196180)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636105"
FT                   /orf_name="MICPUN_56673"
FT                   /product="Kinase/lysine decarboxylase "
FT                   /function="kinase activity"
FT                   /protein_id="ACO61633.1"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="HOGENOM:HBG559924"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="UniParc:UPI000199A6B6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0X7"
FT                   /transl_table=1
FT                   /translation="MKDVDTPHVTPIKGYAADAGKRKRSLDGTPDASPPEVIALETLAV
FT                   IDHSCKVPDHFFKAGPGFKGEVGGSIRVDEETLQTMLVNVGEFSTKAGGSAANTARGLA
FT                   AGFDIRTSLISAVGKDEWGALFTSSMRRAGVDASKTVVRDDPEARTGRCVCLVDKTGQR
FT                   TMRPSFDDKHRLLPNEITPDMFEGSRWVVVNGYSYYSPGFLEAACDAASIAGCKVAMHL
FT                   ASFEIVRKFRPHLTSLLASGKVHVVFANEDEARELVGGGDASSESIETDTKIEAALAKL
FT                   AEWCDIAVVTLGDKGCVAMRDAERVDQKAFKGFDVKDTTGAGDLFSAGFMYGLLRNASL
FT                   ERCCELGCLSGAAVVQTMGAEISADGWTWVHAHMHEGRARSLVRGSAGAVQRELLACYE
FT                   LIESIGRGVVYYGSARLKADNPHFIRSRELGKMVSELLGTPTWTGGGPGMMEAASLGAM
FT                   DAGKAVAGIRIEREAGTKVRSAAQSYLKPEHTVFCKFLSPRKVALVDAGVRKKSEDRTA
FT                   YVFLPGGLGTMDELFELFTLYQLHKLGTDHPVPVIIVNYDGFYDCLLDFVNTMQGHGTV
FT                   GAGEYDQMVVKNTNDEVVDYLKQYYNIEGHDVAA"
     MKDVDTPHVT PIKGYAADAG KRKRSLDGTP DASPPEVIAL ETLAVIDHSC KVPDHFFKAG        60
     PGFKGEVGGS IRVDEETLQT MLVNVGEFST KAGGSAANTA RGLAAGFDIR TSLISAVGKD       120
     EWGALFTSSM RRAGVDASKT VVRDDPEART GRCVCLVDKT GQRTMRPSFD DKHRLLPNEI       180
     TPDMFEGSRW VVVNGYSYYS PGFLEAACDA ASIAGCKVAM HLASFEIVRK FRPHLTSLLA       240
     SGKVHVVFAN EDEARELVGG GDASSESIET DTKIEAALAK LAEWCDIAVV TLGDKGCVAM       300
     RDAERVDQKA FKGFDVKDTT GAGDLFSAGF MYGLLRNASL ERCCELGCLS GAAVVQTMGA       360
     EISADGWTWV HAHMHEGRAR SLVRGSAGAV QRELLACYEL IESIGRGVVY YGSARLKADN       420
     PHFIRSRELG KMVSELLGTP TWTGGGPGMM EAASLGAMDA GKAVAGIRIE REAGTKVRSA       480
     AQSYLKPEHT VFCKFLSPRK VALVDAGVRK KSEDRTAYVF LPGGLGTMDE LFELFTLYQL       540
     HKLGTDHPVP VIIVNYDGFY DCLLDFVNTM QGHGTVGAGE YDQMVVKNTN DEVVDYLKQY       600
     YNIEGHDVAA                                                              610
//

If you have problems or comments...

PBIL Back to PBIL home page