(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE101

MICSR_1.PE101        Location/Qualifiers
FT   CDS             complement(196297..196938)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636106"
FT                   /orf_name="MICPUN_56674"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62080.1"
FT                   /db_xref="UniParc:UPI000199A6B7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0X8"
FT                   /transl_table=1
FT                   /translation="MAAAARVASSSGASSTSRPVPPRRRGRVAASAASTVATDAAQLAA
FT                   GVVAGAALLSIAWPLLERELRPIRCARCRGMGWTVCTNCKGRGKTGCPPLMYATVERRA
FT                   KMRRSTASDDADSEVPIDGSCDGVMIAGPPRSREDAPTCADPETEAAYAPGLVERLSYC
FT                   RECGGKGRCGCDACNRTGIENNWLYGPAANGGWGARGQWRDPANPPPPPP"
     MAAAARVASS SGASSTSRPV PPRRRGRVAA SAASTVATDA AQLAAGVVAG AALLSIAWPL        60
     LERELRPIRC ARCRGMGWTV CTNCKGRGKT GCPPLMYATV ERRAKMRRST ASDDADSEVP       120
     IDGSCDGVMI AGPPRSREDA PTCADPETEA AYAPGLVERL SYCRECGGKG RCGCDACNRT       180
     GIENNWLYGP AANGGWGARG QWRDPANPPP PPP                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page