(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE102

MICSR_1.PE102        Location/Qualifiers
FT   CDS             197061..200516
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636107"
FT                   /orf_name="MICPUN_56675"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /protein_id="ACO61634.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="UniParc:UPI000199A6B8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0X9"
FT                   /transl_table=1
FT                   /translation="MGDEQEKWRRALLKKLRGAAGVKARIDAGDGASLQRSQLARGTAS
FT                   AVADLVARCVEAGLARDGPEIAAALAAGADGGIVAMAAANARGPDGEPGARARRKRERA
FT                   AALAAASSQSGGGGGGGEDAKRTRLDDGDRARGSKRASGECKRATWALHALAKAPDADP
FT                   ASVAVTAKALTAVLRDSKRDAASMDALLASVALYAAAKLRSSALIAEGATDAASDARRE
FT                   LRVCASRVAARVDAQLCARVDARGASNALWALATLASSRGEAGVGERERHAATRALVGA
FT                   LSTRVELRAAFNARDAANALWGCAKARVGLSDEATTQLASAVSGSAPGSAPGSAPGSAP
FT                   PGERGANAVEASMALWALASMRGDGTIGAHVARLAATGVVRRLAECAVKVGPTSTTEVD
FT                   QHRVVANASWAAAKLSERVVSGGGGGDTAGDDPAKMDSEFDAVATGLLRRFASAAVEAG
FT                   PAFQLESPRAAAQLVAALRPSLLDAACGGGGADGVPSADDVAAMTILTHRGLRSCFARG
FT                   REEMEKEARGTRRTSANGAHDVVRKYPESIQKPSSDDLAAFCDAAEALSGFGVVVDAGY
FT                   FRSAVAAACTGGPTALGWRAAGRLEHCVFSVLGLGPVAATVTARGSGSHRGRRGGAAER
FT                   APSADDVAAAERLLRRGAAAAEAANDTRLAMETAAADVLLAVPGPDGPVASGGGGGGRM
FT                   LCVDDTHRLLSRMLRERGGWSVTNWNRFSRKDRRGAPRPPAGAFDAATVRLPPTKAAFA
FT                   MALVAVAARLRAGAVAWIYGADREGVRGCEFDLPDGSFEDVRVVHSCASGGGGGVEGFD
FT                   RGAHVEDSVGSFSVLRCVRTDKPFGVSGSGNPAGGGATQLATRSTTPNRDEDLLEGFKK
FT                   VGRLDVRLGDDVHAFERWVTYPGLFAGGGLDVMTAFLLETMTRSSDGWLGSALRGTPEG
FT                   RGGKEGEFSALDFCSGSGTLAACVRRLAPSARLTLLDADAVAMLAARENLSLPSGSSGA
FT                   SVLDSSEPDGSSPRSVHLPAAFALGDGWTGLSSDERFDLIVSNPPVHLGLRPEFTVLKS
FT                   MCAGFDARLKPGGEAWFVAQRYVPVAGICAGIGGLAAKVARVCANDKFAVWSVRKPPGA
FT                   GREDGSLERKAAKKAKKEKKEKSGGKKEKSGKKEKKEKKEKKYS"
     MGDEQEKWRR ALLKKLRGAA GVKARIDAGD GASLQRSQLA RGTASAVADL VARCVEAGLA        60
     RDGPEIAAAL AAGADGGIVA MAAANARGPD GEPGARARRK RERAAALAAA SSQSGGGGGG       120
     GEDAKRTRLD DGDRARGSKR ASGECKRATW ALHALAKAPD ADPASVAVTA KALTAVLRDS       180
     KRDAASMDAL LASVALYAAA KLRSSALIAE GATDAASDAR RELRVCASRV AARVDAQLCA       240
     RVDARGASNA LWALATLASS RGEAGVGERE RHAATRALVG ALSTRVELRA AFNARDAANA       300
     LWGCAKARVG LSDEATTQLA SAVSGSAPGS APGSAPGSAP PGERGANAVE ASMALWALAS       360
     MRGDGTIGAH VARLAATGVV RRLAECAVKV GPTSTTEVDQ HRVVANASWA AAKLSERVVS       420
     GGGGGDTAGD DPAKMDSEFD AVATGLLRRF ASAAVEAGPA FQLESPRAAA QLVAALRPSL       480
     LDAACGGGGA DGVPSADDVA AMTILTHRGL RSCFARGREE MEKEARGTRR TSANGAHDVV       540
     RKYPESIQKP SSDDLAAFCD AAEALSGFGV VVDAGYFRSA VAAACTGGPT ALGWRAAGRL       600
     EHCVFSVLGL GPVAATVTAR GSGSHRGRRG GAAERAPSAD DVAAAERLLR RGAAAAEAAN       660
     DTRLAMETAA ADVLLAVPGP DGPVASGGGG GGRMLCVDDT HRLLSRMLRE RGGWSVTNWN       720
     RFSRKDRRGA PRPPAGAFDA ATVRLPPTKA AFAMALVAVA ARLRAGAVAW IYGADREGVR       780
     GCEFDLPDGS FEDVRVVHSC ASGGGGGVEG FDRGAHVEDS VGSFSVLRCV RTDKPFGVSG       840
     SGNPAGGGAT QLATRSTTPN RDEDLLEGFK KVGRLDVRLG DDVHAFERWV TYPGLFAGGG       900
     LDVMTAFLLE TMTRSSDGWL GSALRGTPEG RGGKEGEFSA LDFCSGSGTL AACVRRLAPS       960
     ARLTLLDADA VAMLAARENL SLPSGSSGAS VLDSSEPDGS SPRSVHLPAA FALGDGWTGL      1020
     SSDERFDLIV SNPPVHLGLR PEFTVLKSMC AGFDARLKPG GEAWFVAQRY VPVAGICAGI      1080
     GGLAAKVARV CANDKFAVWS VRKPPGAGRE DGSLERKAAK KAKKEKKEKS GGKKEKSGKK      1140
     EKKEKKEKKY S                                                           1151
//

If you have problems or comments...

PBIL Back to PBIL home page