(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE104

MICSR_1.PE104        Location/Qualifiers
FT   CDS             join(complement(202032..202093),complement(201432..201804))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636109"
FT                   /orf_name="MICPUN_56677"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62082.1"
FT                   /db_xref="UniParc:UPI000199A6BA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Y1"
FT                   /transl_table=1
FT                   /translation="MIAAAHTVTVRPAAALSARRGLAGSSLRTAAKPPARAALRVRSTA
FT                   TRAEGIVDDVMADIKKKIADNKEKLERAKIVASPPGVPPPPVVPILEPGKIGFVENAER
FT                   QNSRWSMVGWWSLLLVELVAGKGLLEIMGFTVGKGINFTF"
     MIAAAHTVTV RPAAALSARR GLAGSSLRTA AKPPARAALR VRSTATRAEG IVDDVMADIK        60
     KKIADNKEKL ERAKIVASPP GVPPPPVVPI LEPGKIGFVE NAERQNSRWS MVGWWSLLLV       120
     ELVAGKGLLE IMGFTVGKGI NFTF                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page