(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE105

MICSR_1.PE105        Location/Qualifiers
FT   CDS             join(202395..203186,203277..203588)
FT                   /codon_start=1
FT                   /gene_family="HOG000217543" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636110"
FT                   /orf_name="MICPUN_97114"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61635.1"
FT                   /db_xref="HOGENOM:HBG443829"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI000199A6BB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Y2"
FT                   /transl_table=1
FT                   /translation="MSASAPFGSAKRTEELLSLSFNQDSGCFACGTDGGFRIYNCDPFK
FT                   ETFRRRFDSGGIGQVEMLFRCNILALVGGGRSPRFSPNKVMIWDDHQSRCIGELSFRVE
FT                   VRAVRLRRDRVVVVLEHKIYVYNFADLKILHQTDTVANPLGLCALSPTQDSTVMACPGL
FT                   NKGQVRVELYDLGVTKFISAHDGELAQLQLTLDGALLATASEKGTLIRVYDTASATLMH
FT                   EFRRGADRATVYSIAFAPGKDFLAVSSDKGTVHVYVVPERASGSNQEGGVVDAKAAFSF
FT                   VKGFLPKYFSSEWSLAQFKLPDFTRSLVAFGPEPNTLIVVTVEGTYYKVGFDPKSGGAC
FT                   AQVAFSRFLKTAEEEEEGGWGAVRDVR"
     MSASAPFGSA KRTEELLSLS FNQDSGCFAC GTDGGFRIYN CDPFKETFRR RFDSGGIGQV        60
     EMLFRCNILA LVGGGRSPRF SPNKVMIWDD HQSRCIGELS FRVEVRAVRL RRDRVVVVLE       120
     HKIYVYNFAD LKILHQTDTV ANPLGLCALS PTQDSTVMAC PGLNKGQVRV ELYDLGVTKF       180
     ISAHDGELAQ LQLTLDGALL ATASEKGTLI RVYDTASATL MHEFRRGADR ATVYSIAFAP       240
     GKDFLAVSSD KGTVHVYVVP ERASGSNQEG GVVDAKAAFS FVKGFLPKYF SSEWSLAQFK       300
     LPDFTRSLVA FGPEPNTLIV VTVEGTYYKV GFDPKSGGAC AQVAFSRFLK TAEEEEEGGW       360
     GAVRDVR                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page