(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE106

MICSR_1.PE106        Location/Qualifiers
FT   CDS             <205043..>205345
FT                   /codon_start=1
FT                   /gene_family="HOG000199425" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636111"
FT                   /orf_name="MICPUN_77080"
FT                   /product="Predicted protein"
FT                   /function="two-component sensor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ACO61636.1"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG640751"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="UniParc:UPI000199A6BC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Y3"
FT                   /transl_table=1
FT                   /translation="HALCVADATAKDQPIVFANDNFFVQTGYPPEEVLGRNCRFLQGPG
FT                   TDRETVRAMREAIAKGKEFHGRLMNYHKNGTSLVNSLVMSPLRDEKGVVTHFIGIQ"
     HALCVADATA KDQPIVFAND NFFVQTGYPP EEVLGRNCRF LQGPGTDRET VRAMREAIAK        60
     GKEFHGRLMN YHKNGTSLVN SLVMSPLRDE KGVVTHFIGI Q                           101
//

If you have problems or comments...

PBIL Back to PBIL home page