(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE107

MICSR_1.PE107        Location/Qualifiers
FT   CDS             join(complement(207101..207409),complement(205666..206670))
FT                   /codon_start=1
FT                   /gene_family="HOG000227107" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636112"
FT                   /gene_name="PGK_1"
FT                   /orf_name="MICPUN_104767"
FT                   /product="Phosphoglycerate kinase "
FT                   /function="phosphoglycerate kinase activity"
FT                   /biological_process="glycolysis"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO62083.1"
FT                   /db_xref="GO:0004618"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="HOGENOM:HBG453500"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015901"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="UniParc:UPI000199A6BD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Y4"
FT                   /transl_table=1
FT                   /translation="MAAFAAAPALSARAFFAKSSVRAKKTSVRAQARAALKVEAKKKSV
FT                   GDLKKADLEGKTVFVRCDLNVPLDKDLKITDDTRIRAAIPTLEYLVENGAKVLVTSHLG
FT                   RPKDGPEDKFRLTPVGARLSELLSCSVSKVDDCVGDVVKDAVGGMANGSVCLLENVRFY
FT                   KDEEKNGKDFAKQLSEYADLYVNDAFGTAHRAHASTAGVTEFLSPSVAGFLLQKELDYL
FT                   DGAVSNPDRPFCAIVGGSKVSSKIGVIETLLNKADKVILGGGMIFTFYKALGKDVGSSL
FT                   VEDDKIDLAKELMAKAEEKGVKLLLPTDVVVADAFAADAKTQTVSVDAIPDGWMGLDIG
FT                   PDSVKEFQKELNECKSVIWNGPMGVFEMDAFAKGTFAIADTLANLDGITIIGGGDSVAA
FT                   VEKAGLADKMSHISTGGGASLELLEGKVLPGVDALDEA"
     MAAFAAAPAL SARAFFAKSS VRAKKTSVRA QARAALKVEA KKKSVGDLKK ADLEGKTVFV        60
     RCDLNVPLDK DLKITDDTRI RAAIPTLEYL VENGAKVLVT SHLGRPKDGP EDKFRLTPVG       120
     ARLSELLSCS VSKVDDCVGD VVKDAVGGMA NGSVCLLENV RFYKDEEKNG KDFAKQLSEY       180
     ADLYVNDAFG TAHRAHASTA GVTEFLSPSV AGFLLQKELD YLDGAVSNPD RPFCAIVGGS       240
     KVSSKIGVIE TLLNKADKVI LGGGMIFTFY KALGKDVGSS LVEDDKIDLA KELMAKAEEK       300
     GVKLLLPTDV VVADAFAADA KTQTVSVDAI PDGWMGLDIG PDSVKEFQKE LNECKSVIWN       360
     GPMGVFEMDA FAKGTFAIAD TLANLDGITI IGGGDSVAAV EKAGLADKMS HISTGGGASL       420
     ELLEGKVLPG VDALDEA                                                      437
//

If you have problems or comments...

PBIL Back to PBIL home page