(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE108

MICSR_1.PE108        Location/Qualifiers
FT   CDS             208031..208795
FT                   /codon_start=1
FT                   /gene_family="HOG000264521" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636113"
FT                   /orf_name="MICPUN_99290"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO61637.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG701377"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR013831"
FT                   /db_xref="UniParc:UPI000199A6BE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Y5"
FT                   /transl_table=1
FT                   /translation="MIEYVTRGEWYDGEIRRFVRIDNENPPRKRGVLFVGSSIFREWRE
FT                   ARDFAADVAPLGADCLNRAFGGSTTRDQLDVMEQIVFPHDPKVLVYYCGSNDVNAGVPP
FT                   RVIRDNFLEWCARAFSRCPSARRILFVSIMRAPQKAPVWDALDEANALIREACGEEGEE
FT                   GRRGLKRVSFVDVNPLLRDASTLEPLAQLYRDDGLHFHPSSYDRFAPAIVDAARRALDE
FT                   CGDSVGRGGTGVRGGESSEAPYDPALPPSLGR"
     MIEYVTRGEW YDGEIRRFVR IDNENPPRKR GVLFVGSSIF REWREARDFA ADVAPLGADC        60
     LNRAFGGSTT RDQLDVMEQI VFPHDPKVLV YYCGSNDVNA GVPPRVIRDN FLEWCARAFS       120
     RCPSARRILF VSIMRAPQKA PVWDALDEAN ALIREACGEE GEEGRRGLKR VSFVDVNPLL       180
     RDASTLEPLA QLYRDDGLHF HPSSYDRFAP AIVDAARRAL DECGDSVGRG GTGVRGGESS       240
     EAPYDPALPP SLGR                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page