(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE109

MICSR_1.PE109        Location/Qualifiers
FT   CDS             complement(208827..209576)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636114"
FT                   /orf_name="MICPUN_56682"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO62084.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI000199A6BF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Y6"
FT                   /transl_table=1
FT                   /translation="MARSECLYDLLGVADDATDDELKRAYRDAARLHHPDVNPDAEPGR
FT                   FSAVSSAYDVLRDPNKRRAYDATRAWERGVDGGGAGVRTPGATHATWGGFEEYAKGFAE
FT                   RYHRAHATETEWQRRERMAKAAAERAEMEKEFWIQEKARARHMAVEYRRRAAALKHSRA
FT                   LRHEATIGGFWFSKKGWLPMDFVALFTALAFAGGSAHVWKESGRRKFEARGGRAAGEGE
FT                   ETPVVGAVDPKVEVAAAAVKEGETRHR"
     MARSECLYDL LGVADDATDD ELKRAYRDAA RLHHPDVNPD AEPGRFSAVS SAYDVLRDPN        60
     KRRAYDATRA WERGVDGGGA GVRTPGATHA TWGGFEEYAK GFAERYHRAH ATETEWQRRE       120
     RMAKAAAERA EMEKEFWIQE KARARHMAVE YRRRAAALKH SRALRHEATI GGFWFSKKGW       180
     LPMDFVALFT ALAFAGGSAH VWKESGRRKF EARGGRAAGE GEETPVVGAV DPKVEVAAAA       240
     VKEGETRHR                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page