(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE11

MICSR_1.PE11         Location/Qualifiers
FT   CDS             complement(23336..24058)
FT                   /codon_start=1
FT                   /gene_family="HOG000100014" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636016"
FT                   /orf_name="MICPUN_107846"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62034.1"
FT                   /db_xref="HOGENOM:HBG559987"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI000199AA52"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0N8"
FT                   /transl_table=1
FT                   /translation="MATADRNLTFYTHSLCPYAHRVSLCLAEKAIPHKREHIDLSNKPR
FT                   WYLDLNRRGLVPAIQLDGEVKTESLELNYFLDDVFEGAARLTPDGRKEEMQTLIDSFDG
FT                   SFISAGLQFVGGGWGFRRGAPGPRQADRMAVECERIERIIEINGNGGPYLMGAEVTLAD
FT                   LALWPFAERYELAMREFQGVELREMGPSGSLSRWIDAMRSRPSVVGLRPDDNKLLASWR
FT                   RTMRLDYFDYETADVDNP"
     MATADRNLTF YTHSLCPYAH RVSLCLAEKA IPHKREHIDL SNKPRWYLDL NRRGLVPAIQ        60
     LDGEVKTESL ELNYFLDDVF EGAARLTPDG RKEEMQTLID SFDGSFISAG LQFVGGGWGF       120
     RRGAPGPRQA DRMAVECERI ERIIEINGNG GPYLMGAEVT LADLALWPFA ERYELAMREF       180
     QGVELREMGP SGSLSRWIDA MRSRPSVVGL RPDDNKLLAS WRRTMRLDYF DYETADVDNP       240
//

If you have problems or comments...

PBIL Back to PBIL home page