(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE110

MICSR_1.PE110        Location/Qualifiers
FT   CDS             210593..211957
FT                   /codon_start=1
FT                   /gene_family="HOG000036730" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636115"
FT                   /orf_name="MICPUN_80233"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61638.1"
FT                   /db_xref="HOGENOM:HBG630213"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR022052"
FT                   /db_xref="UniParc:UPI000199A6C0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Y7"
FT                   /transl_table=1
FT                   /translation="MTKPNRREEGGAPIRPAVWRPGVDGMDADEELEYDPSVYDCLHAW
FT                   QLDWPCLSFDILRDELGDTRERFPHSLFAIAGTQADVATKNHLTMMRLTRLKKTRRVDK
FT                   AAADMDDDSDASESDSDDEDGGIAPINGPIIQVQKVAHHGAVNRVRACPHRPSLVATWG
FT                   ETGVVQVWDLAPQLTKLSMLTADARDAQAAMNVQPQRSAPRHAFTGHADEGYAMDWSPT
FT                   VDARLATGDNAGGIHVWEPREGGRWAVDKTAVFKGHESSVEDLQWSPAEAQVFASCGAD
FT                   GYVCVWDARNANAAPALRVKTHECDVNVMSWNRVANCMLATGADDGSLRIWDLRMFSPS
FT                   DAKHVANFSFHRGPVTSVEWSRFDSAMLATASADHTVCVWDLAVERDAEEEAAAMAAED
FT                   NAMAPEDLPPQLMFVHQGLKDPKELHWHHQIPGLCLTTAADGFNAFKAYNVGPGC"
     MTKPNRREEG GAPIRPAVWR PGVDGMDADE ELEYDPSVYD CLHAWQLDWP CLSFDILRDE        60
     LGDTRERFPH SLFAIAGTQA DVATKNHLTM MRLTRLKKTR RVDKAAADMD DDSDASESDS       120
     DDEDGGIAPI NGPIIQVQKV AHHGAVNRVR ACPHRPSLVA TWGETGVVQV WDLAPQLTKL       180
     SMLTADARDA QAAMNVQPQR SAPRHAFTGH ADEGYAMDWS PTVDARLATG DNAGGIHVWE       240
     PREGGRWAVD KTAVFKGHES SVEDLQWSPA EAQVFASCGA DGYVCVWDAR NANAAPALRV       300
     KTHECDVNVM SWNRVANCML ATGADDGSLR IWDLRMFSPS DAKHVANFSF HRGPVTSVEW       360
     SRFDSAMLAT ASADHTVCVW DLAVERDAEE EAAAMAAEDN AMAPEDLPPQ LMFVHQGLKD       420
     PKELHWHHQI PGLCLTTAAD GFNAFKAYNV GPGC                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page