(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE111

MICSR_1.PE111        Location/Qualifiers
FT   CDS             212151..213002
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636116"
FT                   /orf_name="MICPUN_107868"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61639.1"
FT                   /db_xref="InterPro:IPR018971"
FT                   /db_xref="UniParc:UPI000199A6C1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Y8"
FT                   /transl_table=1
FT                   /translation="MASAAGAPAALAARLPRARGCRGARRGVRRVRVSAESPGGREELS
FT                   RPSPPEKFMRFEVRKTLRVPVPEPARVNEAAGRAPRSLERWIQRPENVMEVVFSKEGVI
FT                   PRESGEWRISVIKLPFLDWELNPEFDLRVLPKDAAAREFGVRMVSDALRFAPEGGLEKL
FT                   PPGFAGMDIWSYIDCELFIERLPDDDDGTAGGGARSRTAVCADIDLLIAADIPGVFRWI
FT                   PFFEGIGESAIAGSIESVGEFAQANVQAAYEEWVGAEEAATEPSGAPFGGINLAKREQR
FT                   AR"
     MASAAGAPAA LAARLPRARG CRGARRGVRR VRVSAESPGG REELSRPSPP EKFMRFEVRK        60
     TLRVPVPEPA RVNEAAGRAP RSLERWIQRP ENVMEVVFSK EGVIPRESGE WRISVIKLPF       120
     LDWELNPEFD LRVLPKDAAA REFGVRMVSD ALRFAPEGGL EKLPPGFAGM DIWSYIDCEL       180
     FIERLPDDDD GTAGGGARSR TAVCADIDLL IAADIPGVFR WIPFFEGIGE SAIAGSIESV       240
     GEFAQANVQA AYEEWVGAEE AATEPSGAPF GGINLAKREQ RAR                         283
//

If you have problems or comments...

PBIL Back to PBIL home page