(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE112

MICSR_1.PE112        Location/Qualifiers
FT   CDS             join(213373..213384,213634..213676,213992..214070,
FT                   214242..214300,214568..214719,214896..215579)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636117"
FT                   /orf_name="MICPUN_56685"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61640.1"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI000199A73B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Y9"
FT                   /transl_table=1
FT                   /translation="MANAVLGEHVSEAEMPSKEGYVEAQAFASVHDLVHHAILSRPDHR
FT                   AILKEIYATCEREGRIAYKHGKGSRLLTANEHWKSQIRHALYTSPRFRRVDDGEAWSVS
FT                   NPEAKAPEPVTVRVYPGDDEAVAAQRSHEREEHKREKALAAAAALAAAVDLPHQLPHKA
FT                   SRAVSNSRKRRFSNASTTSDDVSDDSPHKRNRRARHHAQGRAPLAEVAELAQTGQPTNN
FT                   PWRKRDDEGRLHRALRRARENDRGLPRLVSRDSSPEPDGEHEATRDDKPVIVMVGNKPV
FT                   VPKGRDIAHNRRKPLEGHRAAMPSGAIPDAWNSVKCGAGASTGFIYHPSNEFITYHLGL
FT                   SG"
     MANAVLGEHV SEAEMPSKEG YVEAQAFASV HDLVHHAILS RPDHRAILKE IYATCEREGR        60
     IAYKHGKGSR LLTANEHWKS QIRHALYTSP RFRRVDDGEA WSVSNPEAKA PEPVTVRVYP       120
     GDDEAVAAQR SHEREEHKRE KALAAAAALA AAVDLPHQLP HKASRAVSNS RKRRFSNAST       180
     TSDDVSDDSP HKRNRRARHH AQGRAPLAEV AELAQTGQPT NNPWRKRDDE GRLHRALRRA       240
     RENDRGLPRL VSRDSSPEPD GEHEATRDDK PVIVMVGNKP VVPKGRDIAH NRRKPLEGHR       300
     AAMPSGAIPD AWNSVKCGAG ASTGFIYHPS NEFITYHLGL SG                          342
//

If you have problems or comments...

PBIL Back to PBIL home page