(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE113

MICSR_1.PE113        Location/Qualifiers
FT   CDS             join(complement(217131..217382),complement(215924..216913))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636118"
FT                   /orf_name="MICPUN_113699"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO62085.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG559990"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI000199A73C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Z0"
FT                   /transl_table=1
FT                   /translation="MSHRAVVTAREAHARLTAARRYSGGSAGAILKSRHVAPAGRISGR
FT                   WGGVSHRRGSRRGPCLVVAKIWTDDGRRKAAEMMGLTAEEAADEKTLKRAFRRLALRYH
FT                   PDIAKDDAGVEKFHQIQEAYRVLSGADLAHVELPQDQEWDTHDWRWAHRYKGAANGVAG
FT                   VDPEQARRRMGEEERRARVGEQLRSMAGAPTRRKRRVIKPLSAQPSNVAVEFNSGTYDD
FT                   DGGGDECPSDGCASEWAQPARSSADTAGDTAGDEENSTKFAYNARAVRGYQSDRHSTET
FT                   AHERLNAQLAGLHRKKVIRARAMGIEFTESAQSANSGAGKTGRAEDPDAEARRQENKVW
FT                   AAKAARFYGGAGLQLEESTPERFLRLAKLAKEWRDQRSQNSFSQALFSSAEEKMSPKEL
FT                   LQSAVEGASLGACA"
     MSHRAVVTAR EAHARLTAAR RYSGGSAGAI LKSRHVAPAG RISGRWGGVS HRRGSRRGPC        60
     LVVAKIWTDD GRRKAAEMMG LTAEEAADEK TLKRAFRRLA LRYHPDIAKD DAGVEKFHQI       120
     QEAYRVLSGA DLAHVELPQD QEWDTHDWRW AHRYKGAANG VAGVDPEQAR RRMGEEERRA       180
     RVGEQLRSMA GAPTRRKRRV IKPLSAQPSN VAVEFNSGTY DDDGGGDECP SDGCASEWAQ       240
     PARSSADTAG DTAGDEENST KFAYNARAVR GYQSDRHSTE TAHERLNAQL AGLHRKKVIR       300
     ARAMGIEFTE SAQSANSGAG KTGRAEDPDA EARRQENKVW AAKAARFYGG AGLQLEESTP       360
     ERFLRLAKLA KEWRDQRSQN SFSQALFSSA EEKMSPKELL QSAVEGASLG ACA              413
//

If you have problems or comments...

PBIL Back to PBIL home page