(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE114

MICSR_1.PE114        Location/Qualifiers
FT   CDS             217787..219739
FT                   /codon_start=1
FT                   /gene_family="HOG000186562" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636119"
FT                   /orf_name="MICPUN_56687"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO61641.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG384096"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000199A73D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Z1"
FT                   /transl_table=1
FT                   /translation="MADEHKVRVPTRLRSPSSRLRRSRSCYPISRVGARSSSFHRLPTG
FT                   EIARSIRRCSVHSAAYPPDTDLAMIHRYVAAQALGNAAFSAGNYADAVKHFTDAIGVDA
FT                   ANHVFYSNRSAAYAALNDFDAALNDAEKTVAIKPDWVKGHSRKGAALYGLKRYDDACDA
FT                   YQKGLDLEPDNDACKSGLADAETAAVRAMGAAGDGGDPMASMGAMLSSPELYGKLATNP
FT                   ATRGFLSQPDFIAMLTDVQKNPDKFGSYLSDPRMMQVLSVALGINVMSGEDAMKNPDAM
FT                   FTNKGEPTVPNVTKTTPPPPPAPEPTPMAVEPEPEPEPAGPKAEAKKEKELGNAAYKAK
FT                   NFDVALEHYDKAIALDGEDISFITNKAAVYFEKGDFDSCVKACDDAVEKGRELRVDYKL
FT                   VGKAMTRKGNALVKLDRLEDAIEVYGKSLMEHRNADTLKRLNETERELKERTKKAYLDP
FT                   AKADEAREKGNELFKAQKYPEAVEQYTESIARNPDDHRVYSNRAACYTKLTAFNEALKD
FT                   AEKCIELKPDWAKGYTRKGHVEFFTKQYDKALETYQEGLKHDPNNEELKDGLYRTHVEI
FT                   RKASTGQVDEKELAERQQRAMADPEIQGILSDPVMRQVLNDMSTDPKAAQEHQKNPMVM
FT                   AKIQKLINAGIVQTR"
     MADEHKVRVP TRLRSPSSRL RRSRSCYPIS RVGARSSSFH RLPTGEIARS IRRCSVHSAA        60
     YPPDTDLAMI HRYVAAQALG NAAFSAGNYA DAVKHFTDAI GVDAANHVFY SNRSAAYAAL       120
     NDFDAALNDA EKTVAIKPDW VKGHSRKGAA LYGLKRYDDA CDAYQKGLDL EPDNDACKSG       180
     LADAETAAVR AMGAAGDGGD PMASMGAMLS SPELYGKLAT NPATRGFLSQ PDFIAMLTDV       240
     QKNPDKFGSY LSDPRMMQVL SVALGINVMS GEDAMKNPDA MFTNKGEPTV PNVTKTTPPP       300
     PPAPEPTPMA VEPEPEPEPA GPKAEAKKEK ELGNAAYKAK NFDVALEHYD KAIALDGEDI       360
     SFITNKAAVY FEKGDFDSCV KACDDAVEKG RELRVDYKLV GKAMTRKGNA LVKLDRLEDA       420
     IEVYGKSLME HRNADTLKRL NETERELKER TKKAYLDPAK ADEAREKGNE LFKAQKYPEA       480
     VEQYTESIAR NPDDHRVYSN RAACYTKLTA FNEALKDAEK CIELKPDWAK GYTRKGHVEF       540
     FTKQYDKALE TYQEGLKHDP NNEELKDGLY RTHVEIRKAS TGQVDEKELA ERQQRAMADP       600
     EIQGILSDPV MRQVLNDMST DPKAAQEHQK NPMVMAKIQK LINAGIVQTR                  650
//

If you have problems or comments...

PBIL Back to PBIL home page