(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE115

MICSR_1.PE115        Location/Qualifiers
FT   CDS             complement(219822..220583)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636120"
FT                   /orf_name="MICPUN_56688"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62086.1"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="UniParc:UPI000199A73E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Z2"
FT                   /transl_table=1
FT                   /translation="MARGAGARLGAASPSARVAPPTSSSSSSSSSRQTSHRRVTTTRRH
FT                   APPRGASSASDAPIASWMESLADRLPPRFPDAPDTYWRGAGSPAGNPQVHGDDSILDLL
FT                   HASGAFHRPRLMVDEGGARQRVMLSLRTGTRTAGHPGWTHGGLTSLLMDETAGQAFAHF
FT                   VQPSRGLGVTANLTVDYASPLPTAKDLLVVAGVGKVDGRKVWIDVQVRDGPPRDDGGDD
FT                   EAEKHSCAGDDDDDGEVFARGSALFVVLAKD"
     MARGAGARLG AASPSARVAP PTSSSSSSSS SRQTSHRRVT TTRRHAPPRG ASSASDAPIA        60
     SWMESLADRL PPRFPDAPDT YWRGAGSPAG NPQVHGDDSI LDLLHASGAF HRPRLMVDEG       120
     GARQRVMLSL RTGTRTAGHP GWTHGGLTSL LMDETAGQAF AHFVQPSRGL GVTANLTVDY       180
     ASPLPTAKDL LVVAGVGKVD GRKVWIDVQV RDGPPRDDGG DDEAEKHSCA GDDDDDGEVF       240
     ARGSALFVVL AKD                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page