(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE116

MICSR_1.PE116        Location/Qualifiers
FT   CDS             complement(<221452..222259)
FT                   /codon_start=1
FT                   /gene_family="HOG000217543" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636121"
FT                   /orf_name="MICPUN_79584"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62087.1"
FT                   /db_xref="HOGENOM:HBG443829"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI000199A73F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Z3"
FT                   /transl_table=1
FT                   /translation="MQGIGRRDPGSKPGEAVLSCSFNQDRSCLAVATRRGFKIYSCDTG
FT                   TCVYDDSMGAVRIVEMLFCTSLLVVVGAGDTPELSPRRLKVLNTSNHTCIADLTFVSSV
FT                   LAVRLNRARLVVVEERRAVVHDLSTLCVQRTIDTVPNPRGVCALSHDEDSSLLALPAHT
FT                   HAGAVVIHDCVNLHVVCELQCHNSPLAACALTRDGAMLATASAKGTVIRVHCLPHGTKL
FT                   WSFRRGVVNANVRSLCFGAESTMDEPDPGAKLLAASSEKGTVHVWRI"
     MQGIGRRDPG SKPGEAVLSC SFNQDRSCLA VATRRGFKIY SCDTGTCVYD DSMGAVRIVE        60
     MLFCTSLLVV VGAGDTPELS PRRLKVLNTS NHTCIADLTF VSSVLAVRLN RARLVVVEER       120
     RAVVHDLSTL CVQRTIDTVP NPRGVCALSH DEDSSLLALP AHTHAGAVVI HDCVNLHVVC       180
     ELQCHNSPLA ACALTRDGAM LATASAKGTV IRVHCLPHGT KLWSFRRGVV NANVRSLCFG       240
     AESTMDEPDP GAKLLAASSE KGTVHVWRI                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page