(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE117

MICSR_1.PE117        Location/Qualifiers
FT   CDS             222456..224612
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636122"
FT                   /orf_name="MICPUN_56690"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61642.1"
FT                   /db_xref="UniParc:UPI000199A740"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Z4"
FT                   /transl_table=1
FT                   /translation="MVSGGEYQDVLVDALRGALGRDRPPRPPPVPDDVKSVGVQTPAAV
FT                   QNPGGLSGTDDGIPRGVCPACRRAPANWRACGECQRICADGGSSGGGDDDDDDVRPSRT
FT                   LASCLRRSKSRCLFRTWRRRVLSCAEERRDVEKATRHRSGVIFRTWREARRAVRVREHA
FT                   HAKASTFHRRRALKSKLAAWRVHARRVRHLTDLTRSRHQEKVVHGALNAYVRVRRLAPA
FT                   WRAWWRFHVTCDVARDRAEQLGEANVHNFFLVAAAFGKWRTSILHTRRARTERVAADVD
FT                   AKTAQLVERERALDELTGAIIREHVDRTDVELKRALRNEESVLEKLRLMELELRRKDVV
FT                   IEGREAQIATLTEDARAFEATLARRAVEASRAEREIIVAEHEREVAWLRAAVERAFEEC
FT                   VWYRKRYGAVDRDDDLHAFLVRIAGKDRAREMLPRGARLPWVESFAPERDQLATRLGGP
FT                   KQRRAGPVGSRVLGGVPRVPRHGRWGGAHPTHPVTAPWYPSSTLRAGGGSSVGGGSFPG
FT                   FGKGVGGSRAGLRASDRAWEAHRRGFVLASAASNARDFAASKLAIDVRGDATEHAAATP
FT                   RRSVEHEVQYTVEIPPSAAKTADSRPTPTRKSLLDEEESPDREKAWNDEARTSADDVSV
FT                   RSEREKAASVMSVAASMLDFDGEDDKDSASAAVCSDDSDDDLFAARVKPSVRVKPAIAA
FT                   AAKGGDDSDDDDDDWMFRGKGVKA"
     MVSGGEYQDV LVDALRGALG RDRPPRPPPV PDDVKSVGVQ TPAAVQNPGG LSGTDDGIPR        60
     GVCPACRRAP ANWRACGECQ RICADGGSSG GGDDDDDDVR PSRTLASCLR RSKSRCLFRT       120
     WRRRVLSCAE ERRDVEKATR HRSGVIFRTW REARRAVRVR EHAHAKASTF HRRRALKSKL       180
     AAWRVHARRV RHLTDLTRSR HQEKVVHGAL NAYVRVRRLA PAWRAWWRFH VTCDVARDRA       240
     EQLGEANVHN FFLVAAAFGK WRTSILHTRR ARTERVAADV DAKTAQLVER ERALDELTGA       300
     IIREHVDRTD VELKRALRNE ESVLEKLRLM ELELRRKDVV IEGREAQIAT LTEDARAFEA       360
     TLARRAVEAS RAEREIIVAE HEREVAWLRA AVERAFEECV WYRKRYGAVD RDDDLHAFLV       420
     RIAGKDRARE MLPRGARLPW VESFAPERDQ LATRLGGPKQ RRAGPVGSRV LGGVPRVPRH       480
     GRWGGAHPTH PVTAPWYPSS TLRAGGGSSV GGGSFPGFGK GVGGSRAGLR ASDRAWEAHR       540
     RGFVLASAAS NARDFAASKL AIDVRGDATE HAAATPRRSV EHEVQYTVEI PPSAAKTADS       600
     RPTPTRKSLL DEEESPDREK AWNDEARTSA DDVSVRSERE KAASVMSVAA SMLDFDGEDD       660
     KDSASAAVCS DDSDDDLFAA RVKPSVRVKP AIAAAAKGGD DSDDDDDDWM FRGKGVKA         718
//

If you have problems or comments...

PBIL Back to PBIL home page