(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE118

MICSR_1.PE118        Location/Qualifiers
FT   CDS             join(224689..224971,225107..225282)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636123"
FT                   /orf_name="MICPUN_56691"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61643.1"
FT                   /db_xref="UniParc:UPI000199A741"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Z5"
FT                   /transl_table=1
FT                   /translation="MSLTTARRALTRAVCPGTRASFSSSRVASAAATPAAKPKDGARQV
FT                   AEMTPEQIEELSVFQAVGGLTSAAIGGIVVFVIGAGATLGVASGISQVLGHTMNSKAPE
FT                   PPPPPTKDELRARLAEWRKRPRGPERDDAVRAIKDQLRELRRTEGSWW"
     MSLTTARRAL TRAVCPGTRA SFSSSRVASA AATPAAKPKD GARQVAEMTP EQIEELSVFQ        60
     AVGGLTSAAI GGIVVFVIGA GATLGVASGI SQVLGHTMNS KAPEPPPPPT KDELRARLAE       120
     WRKRPRGPER DDAVRAIKDQ LRELRRTEGS WW                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page