(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE119

MICSR_1.PE119        Location/Qualifiers
FT   CDS             complement(225348..228875)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636124"
FT                   /orf_name="MICPUN_56692"
FT                   /product="Predicted protein"
FT                   /biological_process="retrograde transport, endosome to
FT                   Golgi"
FT                   /protein_id="ACO62088.1"
FT                   /db_xref="GO:0042147"
FT                   /db_xref="InterPro:IPR012501"
FT                   /db_xref="UniParc:UPI000199A742"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Z6"
FT                   /transl_table=1
FT                   /translation="MRSSRRGGGRRADHPFPLVPRDPENLDRDPETLKRQTAYLACALN
FT                   DPTELNALHAAQTSATPDASEVLNSLGQYLGVPGFEREPSSGGARGLSAEERPPPLAKG
FT                   VLPEVARGDHDAYLRKVAGWGAFTAANADRRARDAEDEADGRRRNAFDADDDAEHSCAT
FT                   SGIPSSNGEENERRDATDRWTLQRSSDLDRHAHEDVPAMYFDDSFDLSDPAVFRRAFCP
FT                   DDDDDDLNDTAGESSRTAVRASTSSSHPTAVRRSRALFGLAAQTRLGSYLDKIETSLVL
FT                   AIGSRSESFFEASARLHELDAFVSETCETIERTRRTLLDASTYAARARESVASLHSKRA
FT                   NLAALADAFEQLATVRECREDLDVLRRAGDWGGSLEACEDVRRAIASPSLPPGLRLLED
FT                   VAHHADVTERDVVDALVCEFVRAARVQPGSVGYVQHGGERGDDGGGDSPGGDSPGGDSP
FT                   GGGGSWSPATTRAALAAVRAAARDAGMEGVEDEEEDEDEEDAYETDTGLGPGETSAADV
FT                   RESLLPPLMALTRGATDRVSGGRIADAMRAWGRTAAADARACVRAACIACIAAVQPGGE
FT                   YAVAEPGGRNASPESFSGGGRDGIIQRAIGALPPSVFAVVVRAVTVALAGHFARADIVR
FT                   SAVRSALGTAPRRGDDDVGRGQKTKNDDEKNASGTPTDECARAACAALPAGERAAASAA
FT                   ASDAVLALTDAAQGAVARAIASLTKGCTLAEFSNVCDAADDFLERAERLGGGRRCLALR
FT                   ATLAAQCKDLFAARHAAFAAKLGVVLEAETWTAATPVPPEFQRVLDDVVSFAAAGREGN
FT                   EESGDASVTTNGDASSCASADALMFPNTGERVVPVGASLALLKMLRDHVASAARFPSLA
FT                   PTAVHKTAELLRVFNARTAALVLGAGAMRTAGLRSITAKHLALATESVRLFSLVTPLLS
FT                   AALAPALPQSRRRGLLADFDATVKDLATHKRELHAKTVGIMRDRLAHHSSRLPTIWCSR
FT                   VFTGRSRKAGSSVGWRERTEEDESKGESKEDAEARGPSEFATALGKEIGTLRRVIAGTL
FT                   CARDASAVLDEVLAHFDECATGTLREARRSVAKEWMAKMGDDSGEGSGSGDGAGAEGVA
FT                   EGGAEGGAEGGDDAEIASKAPPSDEEVRALIALDGAALLECLGTLVKGGEGGDGAVGAP
FT                   TLTRFLSEL"
     MRSSRRGGGR RADHPFPLVP RDPENLDRDP ETLKRQTAYL ACALNDPTEL NALHAAQTSA        60
     TPDASEVLNS LGQYLGVPGF EREPSSGGAR GLSAEERPPP LAKGVLPEVA RGDHDAYLRK       120
     VAGWGAFTAA NADRRARDAE DEADGRRRNA FDADDDAEHS CATSGIPSSN GEENERRDAT       180
     DRWTLQRSSD LDRHAHEDVP AMYFDDSFDL SDPAVFRRAF CPDDDDDDLN DTAGESSRTA       240
     VRASTSSSHP TAVRRSRALF GLAAQTRLGS YLDKIETSLV LAIGSRSESF FEASARLHEL       300
     DAFVSETCET IERTRRTLLD ASTYAARARE SVASLHSKRA NLAALADAFE QLATVRECRE       360
     DLDVLRRAGD WGGSLEACED VRRAIASPSL PPGLRLLEDV AHHADVTERD VVDALVCEFV       420
     RAARVQPGSV GYVQHGGERG DDGGGDSPGG DSPGGDSPGG GGSWSPATTR AALAAVRAAA       480
     RDAGMEGVED EEEDEDEEDA YETDTGLGPG ETSAADVRES LLPPLMALTR GATDRVSGGR       540
     IADAMRAWGR TAAADARACV RAACIACIAA VQPGGEYAVA EPGGRNASPE SFSGGGRDGI       600
     IQRAIGALPP SVFAVVVRAV TVALAGHFAR ADIVRSAVRS ALGTAPRRGD DDVGRGQKTK       660
     NDDEKNASGT PTDECARAAC AALPAGERAA ASAAASDAVL ALTDAAQGAV ARAIASLTKG       720
     CTLAEFSNVC DAADDFLERA ERLGGGRRCL ALRATLAAQC KDLFAARHAA FAAKLGVVLE       780
     AETWTAATPV PPEFQRVLDD VVSFAAAGRE GNEESGDASV TTNGDASSCA SADALMFPNT       840
     GERVVPVGAS LALLKMLRDH VASAARFPSL APTAVHKTAE LLRVFNARTA ALVLGAGAMR       900
     TAGLRSITAK HLALATESVR LFSLVTPLLS AALAPALPQS RRRGLLADFD ATVKDLATHK       960
     RELHAKTVGI MRDRLAHHSS RLPTIWCSRV FTGRSRKAGS SVGWRERTEE DESKGESKED      1020
     AEARGPSEFA TALGKEIGTL RRVIAGTLCA RDASAVLDEV LAHFDECATG TLREARRSVA      1080
     KEWMAKMGDD SGEGSGSGDG AGAEGVAEGG AEGGAEGGDD AEIASKAPPS DEEVRALIAL      1140
     DGAALLECLG TLVKGGEGGD GAVGAPTLTR FLSEL                                 1175
//

If you have problems or comments...

PBIL Back to PBIL home page