(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE12

MICSR_1.PE12         Location/Qualifiers
FT   CDS             24318..26423
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636017"
FT                   /orf_name="MICPUN_56583"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO61590.1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="UniParc:UPI000199AA53"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0N9"
FT                   /transl_table=1
FT                   /translation="MRAAAKTLAHAFTSSRWVAKRSQRVHNIVRATSSTTAPSPLLRRN
FT                   PRERPADGPTYSFDLGSARVAQLRFLAFHGCGTRYTVLYRECDKVEEQPKGGVGRRGRN
FT                   RAAKEVSDDIGFDAGELESTGEGDGPGWRVRLANSQEITLNALKEITPRDMALAALFDD
FT                   DLGDARLYRRGEERWLASTAAPKWPEELLASLDERGVGVHGANAVTCVDGSYFLELMEL
FT                   SAFPTPVIFPHGAWRLPGVGPTVQGNFRNLASAAIGVDAIDALSAIVNNGAGPDAIGRL
FT                   TGELPGRGRIQLGVDGGRAGVGSAHAAVTENEVTVTFAEGSLGLGFAPLDWERQFGAQV
FT                   WDVDDDSAAAEAGVVPGMVFTHIRGESVDGWTFSEIDREFDGPRPLEVKFNTKVPGAER
FT                   LYAVEMIAEEVTEALLRRKDPEMETFDFEEPGAVFEESTAAVIWREEPSTIFFGDAGST
FT                   TVVHHDIIGQVELCHVLSGSKLLAAAPWGKSSEELLRKAGARGLLSDGKDDGEAEEGVV
FT                   LSAPVHRSLTSDEIALLKHDDLAVVLARPGDCVAFSSICAHFATNGANEPCAAVFHGIL
FT                   TPASTHVLASHPERLDPFSDEEIDEDGFDGHLTGRAVLEELIPAGKDVITDYSAVDKID
FT                   SAMAKESGEKGWRMNRKMRGKAGDAAVKRRFAEAVLNMDSARDVSKAPKMWTGTSRTVF
FT                   YVEPVIK"
     MRAAAKTLAH AFTSSRWVAK RSQRVHNIVR ATSSTTAPSP LLRRNPRERP ADGPTYSFDL        60
     GSARVAQLRF LAFHGCGTRY TVLYRECDKV EEQPKGGVGR RGRNRAAKEV SDDIGFDAGE       120
     LESTGEGDGP GWRVRLANSQ EITLNALKEI TPRDMALAAL FDDDLGDARL YRRGEERWLA       180
     STAAPKWPEE LLASLDERGV GVHGANAVTC VDGSYFLELM ELSAFPTPVI FPHGAWRLPG       240
     VGPTVQGNFR NLASAAIGVD AIDALSAIVN NGAGPDAIGR LTGELPGRGR IQLGVDGGRA       300
     GVGSAHAAVT ENEVTVTFAE GSLGLGFAPL DWERQFGAQV WDVDDDSAAA EAGVVPGMVF       360
     THIRGESVDG WTFSEIDREF DGPRPLEVKF NTKVPGAERL YAVEMIAEEV TEALLRRKDP       420
     EMETFDFEEP GAVFEESTAA VIWREEPSTI FFGDAGSTTV VHHDIIGQVE LCHVLSGSKL       480
     LAAAPWGKSS EELLRKAGAR GLLSDGKDDG EAEEGVVLSA PVHRSLTSDE IALLKHDDLA       540
     VVLARPGDCV AFSSICAHFA TNGANEPCAA VFHGILTPAS THVLASHPER LDPFSDEEID       600
     EDGFDGHLTG RAVLEELIPA GKDVITDYSA VDKIDSAMAK ESGEKGWRMN RKMRGKAGDA       660
     AVKRRFAEAV LNMDSARDVS KAPKMWTGTS RTVFYVEPVI K                           701
//

If you have problems or comments...

PBIL Back to PBIL home page