(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE120

MICSR_1.PE120        Location/Qualifiers
FT   CDS             <229247..>230182
FT                   /codon_start=1
FT                   /gene_family="HOG000171086" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636125"
FT                   /orf_name="MICPUN_68058"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO61644.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG736998"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199A743"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Z7"
FT                   /transl_table=1
FT                   /translation="IRDPEADGWERTDFPIVCEDCLGPNPYIRMQREDYAAECAISSRP
FT                   FTVFRWRPGNEARYKKTVVCREIALAKNVCQVCLLDLDYGIPVQARDAVLGKEREMIAK
FT                   SDVNLEYQTEQIARRLEEGDEVAIRDQNRAVGKVRAAELLQKMARKKPYYNKNKAPICT
FT                   FWLRNACTRADCPYRPCNGDTHMPELTSAPELRQQNIKDRYYGINDPVANRMLAKANES
FT                   KQDLAPPADESITTLYVGGIDDRVTEDALKDAFYQYGQISSVRTLYAKNCAFVTFVDRA
FT                   GAEKAAEECGSRKAISGINARIMWGKSKKEK"
     IRDPEADGWE RTDFPIVCED CLGPNPYIRM QREDYAAECA ISSRPFTVFR WRPGNEARYK        60
     KTVVCREIAL AKNVCQVCLL DLDYGIPVQA RDAVLGKERE MIAKSDVNLE YQTEQIARRL       120
     EEGDEVAIRD QNRAVGKVRA AELLQKMARK KPYYNKNKAP ICTFWLRNAC TRADCPYRPC       180
     NGDTHMPELT SAPELRQQNI KDRYYGINDP VANRMLAKAN ESKQDLAPPA DESITTLYVG       240
     GIDDRVTEDA LKDAFYQYGQ ISSVRTLYAK NCAFVTFVDR AGAEKAAEEC GSRKAISGIN       300
     ARIMWGKSKK EK                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page