(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE121

MICSR_1.PE121        Location/Qualifiers
FT   CDS             complement(230582..231181)
FT                   /codon_start=1
FT                   /gene_family="HOG000100021" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636126"
FT                   /orf_name="MICPUN_107872"
FT                   /product="Predicted protein"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /protein_id="ACO62089.1"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="HOGENOM:HBG559996"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="UniParc:UPI000199A744"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Z8"
FT                   /transl_table=1
FT                   /translation="MGFMFAPRYHPAMKAVVPVRKALKVRTAFNMLGPMLNPAGTQYAL
FT                   VGVYTPDLQPLMADSLMALGMKKALVVCSTVGDLSLDEMTPCGPTSVVEVTPAGTKSYS
FT                   FDPKDVGIPPCELKDLAGGDAKLNARMLTDALGGEKGPVADCLMLNAGVAMAAAAQAES
FT                   VEEGVAMCKEAHAQGKAGDTLRSWIELSQELKLQEA"
     MGFMFAPRYH PAMKAVVPVR KALKVRTAFN MLGPMLNPAG TQYALVGVYT PDLQPLMADS        60
     LMALGMKKAL VVCSTVGDLS LDEMTPCGPT SVVEVTPAGT KSYSFDPKDV GIPPCELKDL       120
     AGGDAKLNAR MLTDALGGEK GPVADCLMLN AGVAMAAAAQ AESVEEGVAM CKEAHAQGKA       180
     GDTLRSWIEL SQELKLQEA                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page