(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE122

MICSR_1.PE122        Location/Qualifiers
FT   CDS             232035..232694
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636127"
FT                   /orf_name="MICPUN_56695"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61645.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199A745"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Z9"
FT                   /transl_table=1
FT                   /translation="MSTIWRPDLLSGDHIVVKEESDDDHQPPAVDVEPPADDHEEDEKS
FT                   EDLAGKMSTIWRPNLSRLYASVAEMEGSESEEEEKDATKKGVKRKRAPPTKGPCEHGVK
FT                   PRSKCKVCSACPHGKWRRFCKECGGASICQHGRQRSKCKECGGGSICEHSRERSQCKEC
FT                   GGASICVHGRQRSQCKECGGASICEHGRRRSECTECGGASICEHGRRRYRCKECKK"
     MSTIWRPDLL SGDHIVVKEE SDDDHQPPAV DVEPPADDHE EDEKSEDLAG KMSTIWRPNL        60
     SRLYASVAEM EGSESEEEEK DATKKGVKRK RAPPTKGPCE HGVKPRSKCK VCSACPHGKW       120
     RRFCKECGGA SICQHGRQRS KCKECGGGSI CEHSRERSQC KECGGASICV HGRQRSQCKE       180
     CGGASICEHG RRRSECTECG GASICEHGRR RYRCKECKK                              219
//

If you have problems or comments...

PBIL Back to PBIL home page