(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE123

MICSR_1.PE123        Location/Qualifiers
FT   CDS             complement(232735..233526)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636128"
FT                   /orf_name="MICPUN_99299"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62090.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199A746"
FT                   /db_xref="UniProtKB/TrEMBL:C1E100"
FT                   /transl_table=1
FT                   /translation="MHCAARAGHLDCVRALGADRERGCDVNARDDHWGTPLHAAVGEGH
FT                   VAIVDWLLANAGADVDAADRDMCTPLHESVRWADARVTAILLARGASPAKRTKRGLTPL
FT                   HVAVAGFGATSRASAAAASALSLHGFVGDGARSDSKRILRLRRGGQVEDGDWYDLRADQ
FT                   ARRDDIVDALLASGACDVDARCFEGGSTPLYLAARWGHAEWVKKLIDAGADVDAARERP
FT                   DPGLGGSVVGPGGPTPLQAARAVGHSECVAVLLEHGAAEAA"
     MHCAARAGHL DCVRALGADR ERGCDVNARD DHWGTPLHAA VGEGHVAIVD WLLANAGADV        60
     DAADRDMCTP LHESVRWADA RVTAILLARG ASPAKRTKRG LTPLHVAVAG FGATSRASAA       120
     AASALSLHGF VGDGARSDSK RILRLRRGGQ VEDGDWYDLR ADQARRDDIV DALLASGACD       180
     VDARCFEGGS TPLYLAARWG HAEWVKKLID AGADVDAARE RPDPGLGGSV VGPGGPTPLQ       240
     AARAVGHSEC VAVLLEHGAA EAA                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page