(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE124

MICSR_1.PE124        Location/Qualifiers
FT   CDS             join(234773..235213,235374..236045)
FT                   /codon_start=1
FT                   /gene_family="HOG000208823" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636129"
FT                   /orf_name="MICPUN_56697"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61646.1"
FT                   /db_xref="HOGENOM:HBG315851"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199A747"
FT                   /db_xref="UniProtKB/TrEMBL:C1E101"
FT                   /transl_table=1
FT                   /translation="MSFGTPGAFGGGGGFGQPAQSPPGAFGAPSPTQPTQVPNPNNDFQ
FT                   VANPPNDGISSLSWSPVANFLVATAWDGDVYCYEVGNNGQAVPKASQKHQGPVLCSDWS
FT                   HDGSAVFSGGCDNKAQKWDLATNTPTQVAQHDAPIKELCWIKEVNLLATGSWDKTLRYW
FT                   DTRQPTPALQVQLPERCYALSCSHPLLVVGTAERHIQVYDLNNPNQPFKQLQSPLKYQT
FT                   RTVAAFPDKSGYLVGSIEGRVAVQHVEDAQQSKNFTFKCHREQSDIYAVNDIKFHPTHG
FT                   TFVTAGADGVFNFWDKDSKQRLKQMAKCNSTIPCGAFNRDGSIYAYAVSYDWSKGGQDP
FT                   MAQSGQNNIFLHAVQESEVKPRPAAVRGRR"
     MSFGTPGAFG GGGGFGQPAQ SPPGAFGAPS PTQPTQVPNP NNDFQVANPP NDGISSLSWS        60
     PVANFLVATA WDGDVYCYEV GNNGQAVPKA SQKHQGPVLC SDWSHDGSAV FSGGCDNKAQ       120
     KWDLATNTPT QVAQHDAPIK ELCWIKEVNL LATGSWDKTL RYWDTRQPTP ALQVQLPERC       180
     YALSCSHPLL VVGTAERHIQ VYDLNNPNQP FKQLQSPLKY QTRTVAAFPD KSGYLVGSIE       240
     GRVAVQHVED AQQSKNFTFK CHREQSDIYA VNDIKFHPTH GTFVTAGADG VFNFWDKDSK       300
     QRLKQMAKCN STIPCGAFNR DGSIYAYAVS YDWSKGGQDP MAQSGQNNIF LHAVQESEVK       360
     PRPAAVRGRR                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page