(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE125

MICSR_1.PE125        Location/Qualifiers
FT   CDS             complement(236336..238801)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636130"
FT                   /orf_name="MICPUN_56698"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62091.1"
FT                   /db_xref="UniParc:UPI000199A7B2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E102"
FT                   /transl_table=1
FT                   /translation="MATCLEPGRAAWRGPVNARGALRGDSTGRPRRAPRPAGTPGTSGE
FT                   RSRSRGARLVNRARADEDGRDAAAAAARLAPLEASTAAGSELERILKTDPVAFERALSD
FT                   QVGSRPPAPPPLLPQSLLSEFTLFFWPTRLGFWPAAARRRGRWDARTRPERAGEGYECG
FT                   CFGASSEGAGGGPRAESPRARSPLASRREEKAQRPLFSRFSARANNASSHERFTRMLTE
FT                   SIPPPIVFPRSQLRAMASDVFHPSFPGGRSGSLRDRVGGSFGAQPSSLQPGHSCDLREK
FT                   PGAGDGFPSTEYLQLEGVISSKGASSGAAEGGAEGGADASMSRLDKSSKGAKNGHPKEP
FT                   CEDERNPSSRPNADKAERVILSELADAVAFGAKVDRANELRDAMYLSVVARHCALGVPL
FT                   VPEVEAFQGSRGSSRGSALFGGSVSGRGVGGGGGRRTGAHDRKVSRLVRECLPTGADEL
FT                   IERHIDRIISDVEAFGLSDGALAGAYRKSALFGYFLRCAATRLALEHSFQATPTRDERL
FT                   PGDDEEHARHLREDGYELVSNISSLPAYPSSIGDWIAEDGDDVDDEQRVDPAVSEARAR
FT                   RRREAEATFRAQATRAKAEATSRTARSDITESTSPRTAGSDEFDADSPEAELERARERR
FT                   RERQWRRALGGAYPDRPLAAFPSSIGDWIASSSSADDDAEYDEPFYEKPIFDAVEDADA
FT                   APNLRAFVDAMEPTLRAQLATIGQADVAAVLDSHVAALFYGDVEAAPRDVRGATAGGDG
FT                   VEAEVVSFDFAGLAGLSKGLMPLDGLRYMVVEACAFGASLWSAERRCERYDLTRRSVDG
FT                   AKDQSESRR"
     MATCLEPGRA AWRGPVNARG ALRGDSTGRP RRAPRPAGTP GTSGERSRSR GARLVNRARA        60
     DEDGRDAAAA AARLAPLEAS TAAGSELERI LKTDPVAFER ALSDQVGSRP PAPPPLLPQS       120
     LLSEFTLFFW PTRLGFWPAA ARRRGRWDAR TRPERAGEGY ECGCFGASSE GAGGGPRAES       180
     PRARSPLASR REEKAQRPLF SRFSARANNA SSHERFTRML TESIPPPIVF PRSQLRAMAS       240
     DVFHPSFPGG RSGSLRDRVG GSFGAQPSSL QPGHSCDLRE KPGAGDGFPS TEYLQLEGVI       300
     SSKGASSGAA EGGAEGGADA SMSRLDKSSK GAKNGHPKEP CEDERNPSSR PNADKAERVI       360
     LSELADAVAF GAKVDRANEL RDAMYLSVVA RHCALGVPLV PEVEAFQGSR GSSRGSALFG       420
     GSVSGRGVGG GGGRRTGAHD RKVSRLVREC LPTGADELIE RHIDRIISDV EAFGLSDGAL       480
     AGAYRKSALF GYFLRCAATR LALEHSFQAT PTRDERLPGD DEEHARHLRE DGYELVSNIS       540
     SLPAYPSSIG DWIAEDGDDV DDEQRVDPAV SEARARRRRE AEATFRAQAT RAKAEATSRT       600
     ARSDITESTS PRTAGSDEFD ADSPEAELER ARERRRERQW RRALGGAYPD RPLAAFPSSI       660
     GDWIASSSSA DDDAEYDEPF YEKPIFDAVE DADAAPNLRA FVDAMEPTLR AQLATIGQAD       720
     VAAVLDSHVA ALFYGDVEAA PRDVRGATAG GDGVEAEVVS FDFAGLAGLS KGLMPLDGLR       780
     YMVVEACAFG ASLWSAERRC ERYDLTRRSV DGAKDQSESR R                           821
//

If you have problems or comments...

PBIL Back to PBIL home page