(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE126

MICSR_1.PE126        Location/Qualifiers
FT   CDS             join(239434..239751,239877..240353)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636131"
FT                   /orf_name="MICPUN_56699"
FT                   /product="Predicted protein"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO61647.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG611525"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI000199A7B3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E103"
FT                   /transl_table=1
FT                   /translation="MSVVAASTFAPFSARVRSAIPARSRRASPSSTRRPVATARAEAEA
FT                   EAGGEGSTLSTTPRTAGRRAGLAAGAGLALAAAAFPARAIGGAAVGLPDVVELTPDNFA
FT                   KQVEVPGTTFVEFYAPWCPFCQRLEPIWNELPNRLKEKGVDTKIARMNVDTYVDYGERF
FT                   GVTGFPTLMLFKDGRPVGQKTGLTDMNTLMKYAGYKESGPLAALAGAGAEMNLVLSGEQ
FT                   VQSAADELNELRRMINGEVDGDKASALAHIDAVERLFAKRAL"
     MSVVAASTFA PFSARVRSAI PARSRRASPS STRRPVATAR AEAEAEAGGE GSTLSTTPRT        60
     AGRRAGLAAG AGLALAAAAF PARAIGGAAV GLPDVVELTP DNFAKQVEVP GTTFVEFYAP       120
     WCPFCQRLEP IWNELPNRLK EKGVDTKIAR MNVDTYVDYG ERFGVTGFPT LMLFKDGRPV       180
     GQKTGLTDMN TLMKYAGYKE SGPLAALAGA GAEMNLVLSG EQVQSAADEL NELRRMINGE       240
     VDGDKASALA HIDAVERLFA KRAL                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page