(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE127

MICSR_1.PE127        Location/Qualifiers
FT   CDS             join(complement(242376..242924),complement(240933..242246),
FT                   complement(240489..240821))
FT                   /codon_start=1
FT                   /gene_family="HOG000201059" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636132"
FT                   /orf_name="MICPUN_80244"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="DNA repair"
FT                   /biological_process="tRNA wobble uridine modification "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO62092.1"
FT                   /db_xref="GO:0002098"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="HOGENOM:HBG284774"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="UniParc:UPI000199A7B4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E104"
FT                   /transl_table=1
FT                   /translation="MLSAVARRASRAAASASSSLGASRVPRRAARDEAARHAIVLTADA
FT                   RRGFASASAHRPTDFDVVVIGGGHAGAEAAAAAARRGARVALVTPSPLGSVGEMSCNPS
FT                   IGGLAKGALVREIDALGGIMGAAADASGIQFRVLNASKGPAVRGPRAQMDRTTYKRSVQ
FT                   AMLFGTPNVEVVDAAAYDLITCAVAGVETADGRKITAEAVVVATGTFLRGVLHVGGRRI
FT                   PAGRMPTAITENPDATAARGAHALADRLYGLGFQMGRLKTGTPPRLDGASIDYSGLEEQ
FT                   RGDEPPRPFGFLHDKAWVPPMKQVSCWATRTNAETERVMKESRGFLNFEGGENGEAIGP
FT                   RYCPSLEMKVKRFPGRSHIVWLEPEGLDTDVVYPNGLSNTLDEPDQIAMLRTVAGLENV
FT                   KMLRPGYGVEYDYVDPRELRWTLETKRVGGLFFAGQINGTTGYEEAAAQGLVAGANAAA
FT                   TALSRLGMDALPPSIVGRGASYLGVLVDDLTRRGTSEPYRMFSSRVEHRLSVRPDNADQ
FT                   RLTAAGELAGLVDSARALIARRRGDATDRAIAALEDARMGAQAWAAHGVDNAPAGKSGR
FT                   TVSAAELLAIPGVGYARVTSALAEAGKTTGESTASGGIDDSRADSATVECYYAPYLARQ
FT                   RRDVETMRKEEAMELPMDLDYDAVGGLSAEDREKLKEFRPATLAAAQRISGVTPSAAIA
FT                   LFRFVAAQKLKGNNKRFSGRRGAVTNGGRDPLMESAL"
     MLSAVARRAS RAAASASSSL GASRVPRRAA RDEAARHAIV LTADARRGFA SASAHRPTDF        60
     DVVVIGGGHA GAEAAAAAAR RGARVALVTP SPLGSVGEMS CNPSIGGLAK GALVREIDAL       120
     GGIMGAAADA SGIQFRVLNA SKGPAVRGPR AQMDRTTYKR SVQAMLFGTP NVEVVDAAAY       180
     DLITCAVAGV ETADGRKITA EAVVVATGTF LRGVLHVGGR RIPAGRMPTA ITENPDATAA       240
     RGAHALADRL YGLGFQMGRL KTGTPPRLDG ASIDYSGLEE QRGDEPPRPF GFLHDKAWVP       300
     PMKQVSCWAT RTNAETERVM KESRGFLNFE GGENGEAIGP RYCPSLEMKV KRFPGRSHIV       360
     WLEPEGLDTD VVYPNGLSNT LDEPDQIAML RTVAGLENVK MLRPGYGVEY DYVDPRELRW       420
     TLETKRVGGL FFAGQINGTT GYEEAAAQGL VAGANAAATA LSRLGMDALP PSIVGRGASY       480
     LGVLVDDLTR RGTSEPYRMF SSRVEHRLSV RPDNADQRLT AAGELAGLVD SARALIARRR       540
     GDATDRAIAA LEDARMGAQA WAAHGVDNAP AGKSGRTVSA AELLAIPGVG YARVTSALAE       600
     AGKTTGESTA SGGIDDSRAD SATVECYYAP YLARQRRDVE TMRKEEAMEL PMDLDYDAVG       660
     GLSAEDREKL KEFRPATLAA AQRISGVTPS AAIALFRFVA AQKLKGNNKR FSGRRGAVTN       720
     GGRDPLMESA L                                                            731
//

If you have problems or comments...

PBIL Back to PBIL home page