(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE128

MICSR_1.PE128        Location/Qualifiers
FT   CDS             243095..244198
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636133"
FT                   /orf_name="MICPUN_52141"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61648.1"
FT                   /db_xref="UniParc:UPI000199A7B5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E105"
FT                   /transl_table=1
FT                   /translation="MLHSWEKIPRSHTSDPEEVCQLSSPTCHLFEIKFGEVDQIAQSSR
FT                   ALPHPRSAMSLVFASALARPTPAPVAGSRRIAPGAAGKPPRPSASPVVAFAKKKGKGGS
FT                   RDGYDDWDDGFGSGSGNYDANFNSIDDDFYTGAGGDYDSFGSKSGAAKPESGKKKGAAK
FT                   RAKKAKGSDVDDGYAPVAGDVSRLIRSKAPAKPESGAIGSSLDSGDGPNFVRPLDGWKK
FT                   KGEASSYGDVFENSAAFSMDDGDLDFGAEPLAAEPIDAPRVVTVAKAVPKKEKREEAKE
FT                   AKAVDPADPGKGEKKASQTLKKWGFAQSNIDDALGATEEAAATAVGEGQTAYNKRRQVL
FT                   ALDWLLLNAPEDAIPMDYRNDAIKARS"
     MLHSWEKIPR SHTSDPEEVC QLSSPTCHLF EIKFGEVDQI AQSSRALPHP RSAMSLVFAS        60
     ALARPTPAPV AGSRRIAPGA AGKPPRPSAS PVVAFAKKKG KGGSRDGYDD WDDGFGSGSG       120
     NYDANFNSID DDFYTGAGGD YDSFGSKSGA AKPESGKKKG AAKRAKKAKG SDVDDGYAPV       180
     AGDVSRLIRS KAPAKPESGA IGSSLDSGDG PNFVRPLDGW KKKGEASSYG DVFENSAAFS       240
     MDDGDLDFGA EPLAAEPIDA PRVVTVAKAV PKKEKREEAK EAKAVDPADP GKGEKKASQT       300
     LKKWGFAQSN IDDALGATEE AAATAVGEGQ TAYNKRRQVL ALDWLLLNAP EDAIPMDYRN       360
     DAIKARS                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page