(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE13

MICSR_1.PE13         Location/Qualifiers
FT   CDS             complement(26475..27071)
FT                   /codon_start=1
FT                   /gene_family="HOG000125745" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636018"
FT                   /orf_name="MICPUN_107847"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62035.1"
FT                   /db_xref="HOGENOM:HBG753188"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI000199AA54"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0P0"
FT                   /transl_table=1
FT                   /translation="MKPNRRGSAVSVRAAGDPPSIYGSPGSRTQIVEWLALELGQDIKS
FT                   VNLNRAIMSSPEYRDVHPFGKIPACKAADGTGIFESGAIMLYLADLAGSLPTPEARGEA
FT                   AAWVIWANATMWPALEASRGKCNLENLFGPVDAILADKAWLLGSELSVADVAVASYIKY
FT                   GQLFFRMDIKAFPNVVRYMEQVEQREAFQSTVMGG"
     MKPNRRGSAV SVRAAGDPPS IYGSPGSRTQ IVEWLALELG QDIKSVNLNR AIMSSPEYRD        60
     VHPFGKIPAC KAADGTGIFE SGAIMLYLAD LAGSLPTPEA RGEAAAWVIW ANATMWPALE       120
     ASRGKCNLEN LFGPVDAILA DKAWLLGSEL SVADVAVASY IKYGQLFFRM DIKAFPNVVR       180
     YMEQVEQREA FQSTVMGG                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page