(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE130

MICSR_1.PE130        Location/Qualifiers
FT   CDS             join(245771..246097,246346..246711)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636470"
FT                   /orf_name="MICPUN_56703"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO61649.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="UniParc:UPI000199A7B7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E107"
FT                   /transl_table=1
FT                   /translation="MAAFTVSMSALVGAPVKVRRIARARAQFVPSSVVGTSPAPQGFHG
FT                   RSGEKASGERRAETTRRENRERSTRARHATGARARSSLAILAARESGEAARRSQTARAA
FT                   RDVIAARAVVARKAVQQRGARLIVRAEGEEAKADSFAGLKPTKAADFKSMSNDELNAQI
FT                   VEAKKMLFELRMKQSTRKEYKGHHFGILKTKIAQIRTVKREREVTEGVNKRDSRKIKRE
FT                   ERAANIYL"
     MAAFTVSMSA LVGAPVKVRR IARARAQFVP SSVVGTSPAP QGFHGRSGEK ASGERRAETT        60
     RRENRERSTR ARHATGARAR SSLAILAARE SGEAARRSQT ARAARDVIAA RAVVARKAVQ       120
     QRGARLIVRA EGEEAKADSF AGLKPTKAAD FKSMSNDELN AQIVEAKKML FELRMKQSTR       180
     KEYKGHHFGI LKTKIAQIRT VKREREVTEG VNKRDSRKIK REERAANIYL                  230
//

If you have problems or comments...

PBIL Back to PBIL home page