(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE131

MICSR_1.PE131        Location/Qualifiers
FT   CDS             complement(246949..248274)
FT                   /codon_start=1
FT                   /gene_family="HOG000006282" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636471"
FT                   /orf_name="MICPUN_56704"
FT                   /product="Predicted protein"
FT                   /function="metalloendopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO62094.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG664087"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="UniParc:UPI000199A7B8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E108"
FT                   /transl_table=1
FT                   /translation="MAPLRASSIVRRGLPDARDDEALIATPVVEVDEATPREDDVDEWF
FT                   PPFAASAPKLGLAGLGAGLLNTGFELDGPASTIEAIVVLATIIFVHECGHFFAARLQNI
FT                   HVSKFSVGFGPNLLSYKGPEVEYSLRWVPLGGFVAFPDDDPDCPYPQDDPDLLRNRPIK
FT                   DRAIVISAGVAANVAFALAILNFQVNTVGLVEQAYKPGVKVAQLLSTSAAREYGVKVGD
FT                   VITAIDGEALPAAGKSVNDVVAKVKAAGSNPVRLKIQRFGTNGPAPPVDIEVVPKTGVN
FT                   GEGRIGVQLEANAEVRKRVAGNPAEGLFLATKEFARLTGLVCKSLFSLVSNFSQAKDNV
FT                   SGPIAIVGVGAEVMRGSDLSGLYQFASVININLAVVNILPLPALDGGFLLLIAVEALRG
FT                   GKKLPAEVEQSITASGVLLLLGSGMFLILRDTLNLVGSLGQH"
     MAPLRASSIV RRGLPDARDD EALIATPVVE VDEATPREDD VDEWFPPFAA SAPKLGLAGL        60
     GAGLLNTGFE LDGPASTIEA IVVLATIIFV HECGHFFAAR LQNIHVSKFS VGFGPNLLSY       120
     KGPEVEYSLR WVPLGGFVAF PDDDPDCPYP QDDPDLLRNR PIKDRAIVIS AGVAANVAFA       180
     LAILNFQVNT VGLVEQAYKP GVKVAQLLST SAAREYGVKV GDVITAIDGE ALPAAGKSVN       240
     DVVAKVKAAG SNPVRLKIQR FGTNGPAPPV DIEVVPKTGV NGEGRIGVQL EANAEVRKRV       300
     AGNPAEGLFL ATKEFARLTG LVCKSLFSLV SNFSQAKDNV SGPIAIVGVG AEVMRGSDLS       360
     GLYQFASVIN INLAVVNILP LPALDGGFLL LIAVEALRGG KKLPAEVEQS ITASGVLLLL       420
     GSGMFLILRD TLNLVGSLGQ H                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page