(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE132

MICSR_1.PE132        Location/Qualifiers
FT   CDS             249135..>249962
FT                   /codon_start=1
FT                   /gene_family="HOG000233016" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636472"
FT                   /orf_name="MICPUN_79493"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO61650.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020655"
FT                   /db_xref="UniParc:UPI000199A7B9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E109"
FT                   /transl_table=1
FT                   /translation="MEVDPPPAAPASAEPGSPPAVNPAPVAPRRIGHWQVDKQIGRGSF
FT                   AVVWRARHAETGQRVAVKEIRLDKLNRKLRESLESEIQVLQRSRHGNIIRLHDIIKEEK
FT                   RIFLVLEYCAGGDVSEFIKKHGRVREDVARHFMRQMASGLRAMRAQNLIHRDLKPQNLL
FT                   LTVASPDAELKIADFGFARYMHPTGMAETLCGSPLYMAPEILGYQKYDAKADLWSVGTI
FT                   LYELLVGRPPFTGMNPMQLLRNIERSDAKIPSKVANGLSRECVSILRGLLRRNP"
     MEVDPPPAAP ASAEPGSPPA VNPAPVAPRR IGHWQVDKQI GRGSFAVVWR ARHAETGQRV        60
     AVKEIRLDKL NRKLRESLES EIQVLQRSRH GNIIRLHDII KEEKRIFLVL EYCAGGDVSE       120
     FIKKHGRVRE DVARHFMRQM ASGLRAMRAQ NLIHRDLKPQ NLLLTVASPD AELKIADFGF       180
     ARYMHPTGMA ETLCGSPLYM APEILGYQKY DAKADLWSVG TILYELLVGR PPFTGMNPMQ       240
     LLRNIERSDA KIPSKVANGL SRECVSILRG LLRRNP                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page