(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE133

MICSR_1.PE133        Location/Qualifiers
FT   CDS             250416..252305
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636473"
FT                   /orf_name="MICPUN_52144"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61651.1"
FT                   /db_xref="UniParc:UPI000199A7BA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E110"
FT                   /transl_table=1
FT                   /translation="MGVRDVAAAAAAAGTNWLSTSPLSRRPGFLGGTSPGGGRPLGGSG
FT                   SHQKPPLSSSPSVARAASFGGFTPGGDGVSVEIQPVPFSLQGSKARSGSDRSLNSMDAE
FT                   YVLVEDDKSGGDKSGGLASMESSPGGSLPSGGGGGGGGLTQMAAGLTRRLSSNLGAVIL
FT                   GSSPPPSKFGNNHHHVTSSSSSPGRELYRMSSSPGGTGLGSGGSPGSFPPRPGSSRHSP
FT                   PGMLGEFRNSPSYPSSRVSSARSGGGGGSGLALGAGASLAPSQSPSEKEAAAALALARV
FT                   AQAAAAAAPGEKRFASAAQRVSVLERAATVLRDVAMERWDSGKKLDALSVSLVSLTALR
FT                   EGYKLAQAVAKEAAEAEACSNAPQGVGPLDGSRNVRLSDMSDSSRSSGGGGGGDCASRP
FT                   ASASSSSSGSPPWIPGRSSSSSQSGTIGSSAELPRLSSKTPERLRKDRERAVKTAERIK
FT                   NAFNAALTRADRAAAAVKGVGVEGSAVLPDAMDLAYDAALALGRSGAVEELMGNTRTAL
FT                   EAYSRAQTLLVFILSEGPRFVTARDEQSGDERAATDAERETAAALVSAPGRAAGDGVET
FT                   GDGSRLITPSVHPCDEFPARGRIARFVGAIGARQQACAATAMRSSSGATRRPP"
     MGVRDVAAAA AAAGTNWLST SPLSRRPGFL GGTSPGGGRP LGGSGSHQKP PLSSSPSVAR        60
     AASFGGFTPG GDGVSVEIQP VPFSLQGSKA RSGSDRSLNS MDAEYVLVED DKSGGDKSGG       120
     LASMESSPGG SLPSGGGGGG GGLTQMAAGL TRRLSSNLGA VILGSSPPPS KFGNNHHHVT       180
     SSSSSPGREL YRMSSSPGGT GLGSGGSPGS FPPRPGSSRH SPPGMLGEFR NSPSYPSSRV       240
     SSARSGGGGG SGLALGAGAS LAPSQSPSEK EAAAALALAR VAQAAAAAAP GEKRFASAAQ       300
     RVSVLERAAT VLRDVAMERW DSGKKLDALS VSLVSLTALR EGYKLAQAVA KEAAEAEACS       360
     NAPQGVGPLD GSRNVRLSDM SDSSRSSGGG GGGDCASRPA SASSSSSGSP PWIPGRSSSS       420
     SQSGTIGSSA ELPRLSSKTP ERLRKDRERA VKTAERIKNA FNAALTRADR AAAAVKGVGV       480
     EGSAVLPDAM DLAYDAALAL GRSGAVEELM GNTRTALEAY SRAQTLLVFI LSEGPRFVTA       540
     RDEQSGDERA ATDAERETAA ALVSAPGRAA GDGVETGDGS RLITPSVHPC DEFPARGRIA       600
     RFVGAIGARQ QACAATAMRS SSGATRRPP                                         629
//

If you have problems or comments...

PBIL Back to PBIL home page