(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE134

MICSR_1.PE134        Location/Qualifiers
FT   CDS             complement(252548..254692)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636474"
FT                   /orf_name="MICPUN_56706"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62095.1"
FT                   /db_xref="UniParc:UPI000199A7BB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E111"
FT                   /transl_table=1
FT                   /translation="MASSDWESTHLVVGAPEGVVELARDLTPLCDILKPDSEVGKVDLI
FT                   RAKATRLIRVCMRTRIGRECLLRRGGLVPSLLAALAPVAKYEDAGADAGADAGADAGAE
FT                   GEEGDGVGPKDPVLEHAMVCGDLLVKLACASTQTALELVEEHGVVETFHALLRRHDADS
FT                   RACGAVGLRKFAKFSERAAREMVWRGVMDDVRAMLPTCDRYRTPPTTPLAMEKDNILAD
FT                   AFGVGAGDEARAKKVDLEALLSSRKRSSKKDETDETEGGGVVYDGPAVPNMGKPPPPPP
FT                   PFVPKANTPRVVAEVMELLGALLCHSFVADQFIGRVGGDVNKRGLLPSGKHRPTWTTTI
FT                   THQCAPAATYAPPPPPPPPPVMVRKLDEEGNPVQATDEEGVPIVDDEGEPVYEMVEEKP
FT                   KTEETEGVEEPEPEPEPEPEPEPEPLAVSEPEPVAKAEVEHDDMLEEYQPVLIEGDAPC
FT                   DDFLACSASLRCLEHAARHPRCRAELLEDDGAHCKRLAAIVRCNMPHCAEPALRILLGI
FT                   MSWAKHEGPNATGPNSFKDLREAQGRVRGGQGGALAAVKAAKAAREAEERETKGGARAY
FT                   DILRCEEVRGAVMSADLGPEDSVMHRSLRSAASHALAGYELTAILPPPPPPAPVPGMEV
FT                   TARAPLPNHKTTPLLETIEKQTLGREIAERDEMREPFFDQVLTIKERLALRYRQTRGHR
FT                   TSRSGSVKDPNELEEVVTEA"
     MASSDWESTH LVVGAPEGVV ELARDLTPLC DILKPDSEVG KVDLIRAKAT RLIRVCMRTR        60
     IGRECLLRRG GLVPSLLAAL APVAKYEDAG ADAGADAGAD AGAEGEEGDG VGPKDPVLEH       120
     AMVCGDLLVK LACASTQTAL ELVEEHGVVE TFHALLRRHD ADSRACGAVG LRKFAKFSER       180
     AAREMVWRGV MDDVRAMLPT CDRYRTPPTT PLAMEKDNIL ADAFGVGAGD EARAKKVDLE       240
     ALLSSRKRSS KKDETDETEG GGVVYDGPAV PNMGKPPPPP PPFVPKANTP RVVAEVMELL       300
     GALLCHSFVA DQFIGRVGGD VNKRGLLPSG KHRPTWTTTI THQCAPAATY APPPPPPPPP       360
     VMVRKLDEEG NPVQATDEEG VPIVDDEGEP VYEMVEEKPK TEETEGVEEP EPEPEPEPEP       420
     EPEPLAVSEP EPVAKAEVEH DDMLEEYQPV LIEGDAPCDD FLACSASLRC LEHAARHPRC       480
     RAELLEDDGA HCKRLAAIVR CNMPHCAEPA LRILLGIMSW AKHEGPNATG PNSFKDLREA       540
     QGRVRGGQGG ALAAVKAAKA AREAEERETK GGARAYDILR CEEVRGAVMS ADLGPEDSVM       600
     HRSLRSAASH ALAGYELTAI LPPPPPPAPV PGMEVTARAP LPNHKTTPLL ETIEKQTLGR       660
     EIAERDEMRE PFFDQVLTIK ERLALRYRQT RGHRTSRSGS VKDPNELEEV VTEA             714
//

If you have problems or comments...

PBIL Back to PBIL home page