(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE135

MICSR_1.PE135        Location/Qualifiers
FT   CDS             254745..255992
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636475"
FT                   /orf_name="MICPUN_56707"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61652.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199A7BC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E112"
FT                   /transl_table=1
FT                   /translation="MRLVASGFGAPASSAAATSSSVGSTTLSNGCSWRHTASTQARHPT
FT                   RCRRISPCLVASAWIARRPARRAASSASASRSFTRLSTTSVSASTSASFLKRRGGASRP
FT                   GRGVRMAFGRVDAGSTRLVPNRDRRLLLGMRAIASSGADVPGIRREFPQLRGGVRASRV
FT                   VGRVAKLLGDRRDEVGTIPILRALPRHGASRVWGAAVRIGLSVIVRHARVEKTEMRGTR
FT                   VIRARGAMGRGGHSDDEGTPYDQRLEEVEFMRSACVAAQRGDVDKLRAMLHRRPDVMLD
FT                   DGVGGDSGYTPLHYAAREGHAECVRALLASGANANARTRAGGATPLHRAAFTGSGACVM
FT                   LLLEGGADPCLRDADGESALHKASANGHADVVRALLRAGGERGIAGERDRKGMTPVERA
FT                   ADEATRAAFGDRVGNC"
     MRLVASGFGA PASSAAATSS SVGSTTLSNG CSWRHTASTQ ARHPTRCRRI SPCLVASAWI        60
     ARRPARRAAS SASASRSFTR LSTTSVSAST SASFLKRRGG ASRPGRGVRM AFGRVDAGST       120
     RLVPNRDRRL LLGMRAIASS GADVPGIRRE FPQLRGGVRA SRVVGRVAKL LGDRRDEVGT       180
     IPILRALPRH GASRVWGAAV RIGLSVIVRH ARVEKTEMRG TRVIRARGAM GRGGHSDDEG       240
     TPYDQRLEEV EFMRSACVAA QRGDVDKLRA MLHRRPDVML DDGVGGDSGY TPLHYAAREG       300
     HAECVRALLA SGANANARTR AGGATPLHRA AFTGSGACVM LLLEGGADPC LRDADGESAL       360
     HKASANGHAD VVRALLRAGG ERGIAGERDR KGMTPVERAA DEATRAAFGD RVGNC            415
//

If you have problems or comments...

PBIL Back to PBIL home page