(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE136

MICSR_1.PE136        Location/Qualifiers
FT   CDS             256081..257505
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636476"
FT                   /orf_name="MICPUN_56708"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO61653.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199A7BD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E113"
FT                   /transl_table=1
FT                   /translation="MPKTPASYETKDLKKLKVADLRAILESKGLDATGKKDELIEKVQA
FT                   SNDAPEPAPEPEPEPEPEPEPEPAPEKSPPAKKPAAKEKPAAKETPAAEEDDDDEPRRA
FT                   NDFFFSTAGADDDDDDDDDEKDEDPAPEPEAPVDRDDDRPATDTRDADDDADDDDDDDT
FT                   AGDEIYLGFLGENCNREFIANLLRPFFECERVHLPMQSAPGGGPKRPKGYAFVRPPRGT
FT                   PDSALAAAVEKLNGSASYPGAKHPLKIAMATRKTNDDDDARGTKRRRDGSGSGGVPQGK
FT                   SPNRLYVLGLPRHVTEVLLKEFFSRFGAVTDARVLASRDGEDDVGPRRGTVTFASADDA
FT                   ARARAETDNTRAFHGGGELKVVYSNLRDGEGGRRGGGGGGGGGGVGGGGASAQPWSVYP
FT                   MQPGMPMYTPMAAVALDPATGQPFAPTGVAAGAGLADHPAAVPPTGLSEAGYTGVHLAG
FT                   LPPSATVDAKYAHLYQ"
     MPKTPASYET KDLKKLKVAD LRAILESKGL DATGKKDELI EKVQASNDAP EPAPEPEPEP        60
     EPEPEPEPAP EKSPPAKKPA AKEKPAAKET PAAEEDDDDE PRRANDFFFS TAGADDDDDD       120
     DDDEKDEDPA PEPEAPVDRD DDRPATDTRD ADDDADDDDD DDTAGDEIYL GFLGENCNRE       180
     FIANLLRPFF ECERVHLPMQ SAPGGGPKRP KGYAFVRPPR GTPDSALAAA VEKLNGSASY       240
     PGAKHPLKIA MATRKTNDDD DARGTKRRRD GSGSGGVPQG KSPNRLYVLG LPRHVTEVLL       300
     KEFFSRFGAV TDARVLASRD GEDDVGPRRG TVTFASADDA ARARAETDNT RAFHGGGELK       360
     VVYSNLRDGE GGRRGGGGGG GGGGVGGGGA SAQPWSVYPM QPGMPMYTPM AAVALDPATG       420
     QPFAPTGVAA GAGLADHPAA VPPTGLSEAG YTGVHLAGLP PSATVDAKYA HLYQ             474
//

If you have problems or comments...

PBIL Back to PBIL home page