(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE137

MICSR_1.PE137        Location/Qualifiers
FT   CDS             complement(257608..258612)
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636477"
FT                   /orf_name="MICPUN_56709"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62096.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199A7BE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E114"
FT                   /transl_table=1
FT                   /translation="MATKTTIWRPNVRVSLDEYGEVEDTESGGEEVAKQGTKRKRAPPT
FT                   KGPCEHGVKPRSRCKVCSACPHGKWRKQCKECGGASICEHGRIRSVCKECGGASICEHG
FT                   RQRSQCKECGGSEICEHGRHRSKCKECGGSQICEHGRQRHRCKECGGSSICEHGRHRPQ
FT                   CKECGGASICEHGRHRYSCKECGGASICEHGRHRSKCKECGGSQICEHGRQRSRCKECG
FT                   GGSICEHGRERSLCKECGGSQICEHGRRRSRCKECGGGSICEHGRIRSQCKECGGASIC
FT                   EHGRQRSQCKECGGSQICEHGRRRSQCKECGGGSICEHGRIRSQCKDCRCERL"
     MATKTTIWRP NVRVSLDEYG EVEDTESGGE EVAKQGTKRK RAPPTKGPCE HGVKPRSRCK        60
     VCSACPHGKW RKQCKECGGA SICEHGRIRS VCKECGGASI CEHGRQRSQC KECGGSEICE       120
     HGRHRSKCKE CGGSQICEHG RQRHRCKECG GSSICEHGRH RPQCKECGGA SICEHGRHRY       180
     SCKECGGASI CEHGRHRSKC KECGGSQICE HGRQRSRCKE CGGGSICEHG RERSLCKECG       240
     GSQICEHGRR RSRCKECGGG SICEHGRIRS QCKECGGASI CEHGRQRSQC KECGGSQICE       300
     HGRRRSQCKE CGGGSICEHG RIRSQCKDCR CERL                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page